VIP

also known as vasoactive intestinal peptide

research compound hormone cardiovasculargastrointestinalimmunerespiratory modified — mass check n/a

234 heavy atoms · 474 bonds · drag to pan, scroll to zoom C147O43N43S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 53314964. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

HSDAVFTDNYTRLRKQMAVKKYLNSILN

His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C147H237N43O43S
molecular weight	3326.8 Da (PubChem)
computed backbone mass	3326.82 Da
length	28 residues
net charge (pH 7.4)	+3
mean hydropathy	-0.64
half-life	not characterised
delivery route	not characterised
PubChem CID	53314964
PDB	not characterised
UniProt parent	P01282

Mechanism

VPAC1/VPAC2 receptor agonist; vasodilator and immunomodulator.

Reported targets: VPAC1 VPAC2

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 125–152 of VIP peptides (170 aa)

…KYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Parent sequence from UniProt P01282. Cleaved from the VIP precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
vasodilation	Intranasal delivery of a vasoactive intestinal peptide-based circRNA vaccine… Molecular therapy : the journal of the American Society of Gene Therapy 2026
anti-inflammatory activity in models	The Role of Vasoactive Intestinal Peptide in Glucagon-like Peptide-2-Mediate… International journal of molecular sciences 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT04260035	The Effects of a Long-lasting Infusion of Vasoactive Intestinal Peptide (VIP) in Episodic Mi	COMPLETED	NA
NCT05318157	Efficacy of Artemisia Pollen Specific Allergen Immunotherapy	UNKNOWN	PHASE4
NCT01916395	Comparison of Treximet & Imitrex as They Affect the Levels of Inflammatory Markers When the	COMPLETED	—
NCT00112684	Alvocidib in Treating Patients With Locally Advanced or Metastatic Solid Tumors	TERMINATED	PHASE1
NCT03989817	The Effects of a Long-lasting Infusion of Vasoactive Intestinal Peptide (VIP) on Headache, C	COMPLETED	NA

Literature (8)

Intranasal delivery of a vasoactive intestinal peptide-based circRNA vaccine induces systemic and mucosal immunity against RSV in mice — Molecular therapy : the journal of the American Society of Gene Therapy 2026