biohacking$bioLLM CA: TBA

database / hormone

Vasopressin

also known as ADH, antidiuretic hormone

approved hormone renalcardiovascularnervous modified — mass check n/a

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

CYFQNCPRG

Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly

1. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C12. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y3. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F4. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q5. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N6. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C67. Pro — Proline · proline · hydropathy -1.6 · charge 0P8. Arg — Arginine · positive · hydropathy -4.5 · charge +1R9. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G9

Modified molecule. Cyclic via a Cys1–Cys6 disulfide, C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulanot characterised
molecular weight1087.24 Da (computed from sequence)
computed backbone mass1087.24 Da
length9 residues
net charge (pH 7.4)+1
mean hydropathy-0.78
half-lifenot characterised
delivery routeintravenous
PubChem CIDnot characterised
PDBnot characterised
UniProt parentP01185

Mechanism

V1/V2 receptor agonist regulating water retention and vascular tone.

Reported targets: V1aR V2R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 20–28 of Vasopressin-neurophysin 2-copeptin (164 aa)

MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRC…

Parent sequence from UniProt P01185. Cleaved from the AVP precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
antidiuresisTransient diabetes insipidus in post CABG patient after vasopressin withdraw… Bioinformation 2025
vasoconstrictionAnatomy, Neurohypophysis StatPearls Publishing, Treasure Island (FL) 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT04110418Methylene Blue Versus Vasopressin Analogue for Treatment of Septic Shock in Preterm NeonateUNKNOWNPHASE2
NCT05661708Use of Chitosan Powder in Loop Electrosurgical Excision ProcedureCOMPLETEDPHASE4
NCT01884766Copeptin in Childhood EpilepsyCOMPLETED
NCT01078753Study With Two Different Doses of Desmopressin Orally Lyophilisate Tablet With Nocturnal EnuCOMPLETEDPHASE3
NCT07671365Angiotensin II for Post Cardiac Surgery Vasoplegia (ANGII_V)NOT_YET_RECRUITINGPHASE4

Literature (8)

Transient diabetes insipidus in post CABG patient after vasopressin withdrawal: A report — Bioinformation 2025

Vasopressin is increasingly being used as inotropic agent due to its catecholamine's sparing property. Vasopressin is instrumental in rapid adjustment of water excretion according to the state of body hydration. It is also used in treatment of DI; Arginine vasopressin disorder, formerly known as diabetes insipidus (DI), is a disease process that results in either decreased release of antidiuretic hormone (Anti Diuretic Hormone (ADH), also known as vasopressin or Arginine Vasopressin (AVP) or reduced response to ADH, causing electrolyte imbalances. however, there are only anecdote reports discussing the precipitation of DI d/t vasopressin withdrawal. Hence, we report a case of diabetes insipidus in post Coronary artery bypass grafting after vasopressin withdrawal.

open access ↗ · PMID 41623817 · DOI 10.6026/973206300213564

Anatomy, Neurohypophysis — StatPearls Publishing, Treasure Island (FL) 2026

The neurohypophysis (pars posterior) is the posterior lobe of the pituitary gland, located at the base of the brain. The embryological origin of this structure is the neuroectodermal infundibulum. The neurohypophysis comprises 2 primary regions, the pars nervosa and the infundibular stalk. The pars intermedia and median eminence are sometimes included. The neurohypophysis secretes the 2 peptide hormones, oxytocin and vasopressin. Oxytocin stimulates uterine contractions and milk ejection. Vasopressin, also known as antidiuretic hormone (ADH), prevents diuresis. These hormones are synthesized by magnocellular neurosecretory cells of the hypothalamus, specifically within the paraventricular and supraoptic nuclei. Axons from these neurons project to the neurohypophysis, transporting the hormones for storage and subsequent release into the neurohypophyseal capillaries, which deliver these ne…

open access ↗ · PMID 32809568

Giant sellar aneurysm presenting with arginine vasopressin deficiency: a rare case report — Frontiers in endocrinology 2026

Giant aneurysms are rare vascular anomalies that can induce symptoms through compression of neural structures. This report describes a case of a giant sellar aneurysm initially manifesting as diabetes insipidus (DI), challenging conventional diagnostic paradigms for sellar mass lesions. Although DI typically arises from antidiuretic hormone (ADH) deficiency, its presentation as the primary symptom of a giant sellar aneurysm is exceedingly uncommon. The distinctiveness of this case lies in the occurrence of DI, likely due to aneurysmal compression of the pituitary gland, underscoring the imperative to include aneurysms in the differential diagnosis of sellar lesions. Giant sellar aneurysms are frequently misdiagnosed as pituitary adenomas, particularly when atypical symptoms are present. Through multidisciplinary collaboration, this case was successfully managed, yielding valuable clinica…

open access ↗ · PMID 42318214 · DOI 10.3389/fendo.2026.1737157

Early-Onset Hyponatremia Presenting as Syndrome of Inappropriate Antidiuretic Hormone Secretion (SIADH) Post-transsphenoidal Pituitary Resection — Cureus 2026

Syndrome of inappropriate antidiuretic hormone secretion (SIADH) is a disorder in which an excessive amount of antidiuretic hormone (ADH) is released, leading to water retention and subsequent hyponatremia. Delayed hyponatremia, typically beginning on postoperative day (POD) 4, is a well-recognized complication following transsphenoidal resection of pituitary tumors and is thought to result from excess release of stored ADH due to surgical trauma. In this rare case of early symptomatic hyponatremia secondary to SIADH, a 61-year-old postmenopausal woman with no significant past medical history developed symptomatic hyponatremia on POD 1 after elective transsphenoidal resection of a nonfunctioning pituitary neuroendocrine tumor. Her serum sodium reached a nadir of [dose redacted] on POD 2. Urine osmolality was 961 mOsm/kg on POD 1, consistent with SIADH. She was treated with fluid restriction, …

open access ↗ · PMID 41994839 · DOI 10.7759/cureus.105276

Neuroanatomy, Pars Nervosa — StatPearls Publishing, Treasure Island (FL) 2026

The pars nervosa (neurohypophysis or posterior pituitary) is a neuroendocrine structure that, together with the anterior and intermediate lobes, constitutes the pituitary gland. The pars nervosa connects to the hypothalamus via the infundibular stalk and resides within the sella turcica, a saddle-shaped indentation of the sphenoid bone located superior to the nasopharynx. The structure functions in the storage and release of the neurohypophysial hormones oxytocin and arginine vasopressin (AVP; also antidiuretic hormone or ADH), which are synthesized in hypothalamic neurons, into the systemic circulation. These hormones exert critical effects on blood pressure and osmolarity regulation, as well as on parturition and lactation. Consequently, regulated secretion of oxytocin and AVP represents the primary physiologic role of the pars nervosa (see Image. Structural Components of the Pituitary…

open access ↗ · PMID 31613526

An Uncommon Link: Syndrome of Inappropriate Antidiuretic Hormone Secretion (SIADH) in the Setting of Myeloproliferative Neoplasms — Cureus 2026

Syndrome of inappropriate antidiuretic hormone secretion (SIADH) is a well-known cause of hyponatremia, frequently associated with small-cell lung carcinoma. Its association with myeloproliferative neoplasms (MPNs), however, is rare and underreported. We describe the case of an 81-year-old female with a history of chronic hyponatremia attributed to SIADH, requiring multiple hospitalizations. During her hospitalizations, she would be on fluid restriction and urea tablets. Her medical history included paroxysmal atrial fibrillation, a stable pulmonary nodule, and seropositive rheumatoid arthritis. Initial hematologic evaluations for cytopenias were unremarkable. Nearly a decade later, she developed pancytosis, and subsequent testing revealed a JAK2 V617F mutation with a 40.1% clone size. A bone marrow biopsy confirmed a diagnosis of polycythemia vera, an MPN. Treatment with intermittent ph…

open access ↗ · PMID 41756340 · DOI 10.7759/cureus.104231

ENaC processing in rat kidney: effects of salt loading and ADH — American journal of physiology. Renal physiology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41995738 · DOI 10.1152/ajprenal.00072.2026

Syndrome of inappropriate antidiuretic hormone secretion following immune effector cell-associated neurotoxicity syndrome during blinatumomab therapy: a case report — Journal of pharmaceutical health care and sciences 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42432807 · DOI 10.1186/s40780-026-00606-x

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations

Insulin

hormone · 8 citations