database / hormone
Vasopressin
also known as ADH, antidiuretic hormone
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
CYFQNCPRG
Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. Cyclic via a Cys1–Cys6 disulfide, C-terminal amide.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | not characterised |
|---|---|
| molecular weight | 1087.24 Da (computed from sequence) |
| computed backbone mass | 1087.24 Da |
| length | 9 residues |
| net charge (pH 7.4) | +1 |
| mean hydropathy | -0.78 |
| half-life | not characterised |
| delivery route | intravenous |
| PubChem CID | not characterised |
| PDB | not characterised |
| UniProt parent | P01185 |
Mechanism
V1/V2 receptor agonist regulating water retention and vascular tone.
Reported targets: V1aR V2R
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Position in the parent protein
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRC…
Parent sequence from UniProt P01185. Cleaved from the AVP precursor.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| antidiuresis | Transient diabetes insipidus in post CABG patient after vasopressin withdraw… Bioinformation 2025 |
| vasoconstriction | Anatomy, Neurohypophysis StatPearls Publishing, Treasure Island (FL) 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT04110418 | Methylene Blue Versus Vasopressin Analogue for Treatment of Septic Shock in Preterm Neonate | UNKNOWN | PHASE2 |
| NCT05661708 | Use of Chitosan Powder in Loop Electrosurgical Excision Procedure | COMPLETED | PHASE4 |
| NCT01884766 | Copeptin in Childhood Epilepsy | COMPLETED | — |
| NCT01078753 | Study With Two Different Doses of Desmopressin Orally Lyophilisate Tablet With Nocturnal Enu | COMPLETED | PHASE3 |
| NCT07671365 | Angiotensin II for Post Cardiac Surgery Vasoplegia (ANGII_V) | NOT_YET_RECRUITING | PHASE4 |
Literature (8)
Transient diabetes insipidus in post CABG patient after vasopressin withdrawal: A report — Bioinformation 2025
Vasopressin is increasingly being used as inotropic agent due to its catecholamine's sparing property. Vasopressin is instrumental in rapid adjustment of water excretion according to the state of body hydration. It is also used in treatment of DI; Arginine vasopressin disorder, formerly known as diabetes insipidus (DI), is a disease process that results in either decreased release of antidiuretic hormone (Anti Diuretic Hormone (ADH), also known as vasopressin or Arginine Vasopressin (AVP) or reduced response to ADH, causing electrolyte imbalances. however, there are only anecdote reports discussing the precipitation of DI d/t vasopressin withdrawal. Hence, we report a case of diabetes insipidus in post Coronary artery bypass grafting after vasopressin withdrawal.
open access ↗ · PMID 41623817 · DOI 10.6026/973206300213564
Anatomy, Neurohypophysis — StatPearls Publishing, Treasure Island (FL) 2026
The neurohypophysis (pars posterior) is the posterior lobe of the pituitary gland, located at the base of the brain. The embryological origin of this structure is the neuroectodermal infundibulum. The neurohypophysis comprises 2 primary regions, the pars nervosa and the infundibular stalk. The pars intermedia and median eminence are sometimes included. The neurohypophysis secretes the 2 peptide hormones, oxytocin and vasopressin. Oxytocin stimulates uterine contractions and milk ejection. Vasopressin, also known as antidiuretic hormone (ADH), prevents diuresis. These hormones are synthesized by magnocellular neurosecretory cells of the hypothalamus, specifically within the paraventricular and supraoptic nuclei. Axons from these neurons project to the neurohypophysis, transporting the hormones for storage and subsequent release into the neurohypophyseal capillaries, which deliver these ne…
open access ↗ · PMID 32809568
Giant sellar aneurysm presenting with arginine vasopressin deficiency: a rare case report — Frontiers in endocrinology 2026
Giant aneurysms are rare vascular anomalies that can induce symptoms through compression of neural structures. This report describes a case of a giant sellar aneurysm initially manifesting as diabetes insipidus (DI), challenging conventional diagnostic paradigms for sellar mass lesions. Although DI typically arises from antidiuretic hormone (ADH) deficiency, its presentation as the primary symptom of a giant sellar aneurysm is exceedingly uncommon. The distinctiveness of this case lies in the occurrence of DI, likely due to aneurysmal compression of the pituitary gland, underscoring the imperative to include aneurysms in the differential diagnosis of sellar lesions. Giant sellar aneurysms are frequently misdiagnosed as pituitary adenomas, particularly when atypical symptoms are present. Through multidisciplinary collaboration, this case was successfully managed, yielding valuable clinica…
open access ↗ · PMID 42318214 · DOI 10.3389/fendo.2026.1737157
Early-Onset Hyponatremia Presenting as Syndrome of Inappropriate Antidiuretic Hormone Secretion (SIADH) Post-transsphenoidal Pituitary Resection — Cureus 2026
Syndrome of inappropriate antidiuretic hormone secretion (SIADH) is a disorder in which an excessive amount of antidiuretic hormone (ADH) is released, leading to water retention and subsequent hyponatremia. Delayed hyponatremia, typically beginning on postoperative day (POD) 4, is a well-recognized complication following transsphenoidal resection of pituitary tumors and is thought to result from excess release of stored ADH due to surgical trauma. In this rare case of early symptomatic hyponatremia secondary to SIADH, a 61-year-old postmenopausal woman with no significant past medical history developed symptomatic hyponatremia on POD 1 after elective transsphenoidal resection of a nonfunctioning pituitary neuroendocrine tumor. Her serum sodium reached a nadir of [dose redacted] on POD 2. Urine osmolality was 961 mOsm/kg on POD 1, consistent with SIADH. She was treated with fluid restriction, …
open access ↗ · PMID 41994839 · DOI 10.7759/cureus.105276
Neuroanatomy, Pars Nervosa — StatPearls Publishing, Treasure Island (FL) 2026
The pars nervosa (neurohypophysis or posterior pituitary) is a neuroendocrine structure that, together with the anterior and intermediate lobes, constitutes the pituitary gland. The pars nervosa connects to the hypothalamus via the infundibular stalk and resides within the sella turcica, a saddle-shaped indentation of the sphenoid bone located superior to the nasopharynx. The structure functions in the storage and release of the neurohypophysial hormones oxytocin and arginine vasopressin (AVP; also antidiuretic hormone or ADH), which are synthesized in hypothalamic neurons, into the systemic circulation. These hormones exert critical effects on blood pressure and osmolarity regulation, as well as on parturition and lactation. Consequently, regulated secretion of oxytocin and AVP represents the primary physiologic role of the pars nervosa (see Image. Structural Components of the Pituitary…
open access ↗ · PMID 31613526
An Uncommon Link: Syndrome of Inappropriate Antidiuretic Hormone Secretion (SIADH) in the Setting of Myeloproliferative Neoplasms — Cureus 2026
Syndrome of inappropriate antidiuretic hormone secretion (SIADH) is a well-known cause of hyponatremia, frequently associated with small-cell lung carcinoma. Its association with myeloproliferative neoplasms (MPNs), however, is rare and underreported. We describe the case of an 81-year-old female with a history of chronic hyponatremia attributed to SIADH, requiring multiple hospitalizations. During her hospitalizations, she would be on fluid restriction and urea tablets. Her medical history included paroxysmal atrial fibrillation, a stable pulmonary nodule, and seropositive rheumatoid arthritis. Initial hematologic evaluations for cytopenias were unremarkable. Nearly a decade later, she developed pancytosis, and subsequent testing revealed a JAK2 V617F mutation with a 40.1% clone size. A bone marrow biopsy confirmed a diagnosis of polycythemia vera, an MPN. Treatment with intermittent ph…
open access ↗ · PMID 41756340 · DOI 10.7759/cureus.104231
ENaC processing in rat kidney: effects of salt loading and ADH — American journal of physiology. Renal physiology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41995738 · DOI 10.1152/ajprenal.00072.2026
Syndrome of inappropriate antidiuretic hormone secretion following immune effector cell-associated neurotoxicity syndrome during blinatumomab therapy: a case report — Journal of pharmaceutical health care and sciences 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42432807 · DOI 10.1186/s40780-026-00606-x
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations
Insulin
hormone · 8 citations