Oxytocin

approved hormone reproductivenervous modified — mass check n/a

69 heavy atoms · 137 bonds · drag to pan, scroll to zoom C43O12N12S2

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 439302. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

CYIQNCPLG

Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. Cyclic via a Cys1–Cys6 disulfide, with a C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C43H66N12O12S2
molecular weight	1007.2 Da (PubChem)
computed backbone mass	1010.19 Da
length	9 residues
net charge (pH 7.4)	0
mean hydropathy	0.33
half-life	not characterised
delivery route	intravenous, intranasal
PubChem CID	439302
PDB	1XY1
UniProt parent	P01178

Mechanism

Oxytocin receptor agonist; neurohypophysial nonapeptide.

Reported targets: OXTR

Experimental structure

α-carbon backbone trace rendered from the deposited coordinates of PDB 1XY1. This is measured structure, not a prediction.

Position in the parent protein

exact match at residues 20–28 of Oxytocin-neurophysin 1 proprotein (125 aa)

MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRC…

Parent sequence from UniProt P01178. Cleaved from the oxytocin-neurophysin precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
uterine contraction	Gene-environment interaction between perinatal oxytocin exposure and Pten mu… Neurobiology of disease 2026
social-behaviour effects in trials	Oxytocin National Institute of Child Health and Human Development, Bethesda (MD) 2006
lactation	Relation between serum oxytocin levels and impulsivity in patients under tre… International journal of psychiatry in clinical practice 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT05916989	Stimulant Use and Methylation in HIV	COMPLETED	—
NCT02888574	Evaluating the Efficacy of Intranasal Oxytocin Among Individuals With Persistent Pain	COMPLETED	PHASE2, PHASE3
NCT07299708	Effects of Sleep Quality, Anxiety, and Digital Behavior on Labor Progression in Term Primipa	COMPLETED	—
NCT03119610	The Physiologic Effects of Intranasal Oxytocin on Sarcopenic Obesity	COMPLETED	PHASE1, PHASE2
NCT00451308	Induction of Labor With a Foley Balloon Catheter: Inflation With 30ml Compared to 60ml	COMPLETED	PHASE4

Literature (8)

Gene-environment interaction between perinatal oxytocin exposure and Pten mutation shapes epigenetic reprogramming of oxytocin signaling and behavior in mice — Neurobiology of disease 2026