biohacking$bioLLM CA: TBA

the lab

Phase 1 of 3

Read this first. Everything on this page is computational. No candidate here has been validated, synthesised, or tested in any living system. Nothing here is a drug, a product, or a claim that any sequence does anything. No patent has been filed on any of it, and none will be — the point of the registry is the opposite.

Where this actually is

Saying so plainly costs nothing. A dashboard pretending to be phase 3 would be found out in an afternoon.

The method, in full

The run below is reproducible: bun run data/generate-candidates.ts with a fixed seed produces exactly these sequences, every time.

  1. Read the 100-entry corpus; keep the 62 entries with an established sequence.
  2. For a target class, build an order-2 residue Markov model from that class's sequences, backing off to the whole-corpus model for unseen contexts.
  3. Sample candidates inside the class's observed length range.
  4. Reject any candidate that is a substring of a known peptide, contains one, or sits within 0.5 normalised edit distance of any indexed sequence.
  5. Reject any candidate whose net charge or mean hydropathy falls outside the class's observed ranges.
  6. Score what remains on composition similarity to the class centroid and on novelty; hash the survivors.

What the score is not. The composite is a weighted blend of composition similarity, novelty and physicochemical range fit. It is not a prediction of binding, activity, safety or efficacy. No such prediction is made anywhere on this site.

Run log

Candidates (11)

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C001

LKKTETIEQEKQAGLVQPGKPDMAEIEKQAGEPPG

1. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L12. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Thr — Threonine · polar · hydropathy -0.7 · charge 0T5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. Thr — Threonine · polar · hydropathy -0.7 · charge 0T67. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I8. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E9. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q13. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A14. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G15. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L16. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V1617. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q18. Pro — Proline · proline · hydropathy -1.6 · charge 0P19. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G20. Lys — Lysine · positive · hydropathy -3.9 · charge +1K21. Pro — Proline · proline · hydropathy -1.6 · charge 0P2122. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D23. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M24. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A25. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E26. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I2627. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E28. Lys — Lysine · positive · hydropathy -3.9 · charge +1K29. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q30. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A31. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G3132. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E33. Pro — Proline · proline · hydropathy -1.6 · charge 0P34. Pro — Proline · proline · hydropathy -1.6 · charge 0P35. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G35
healing 35 residues 3776 Da computational score 0.824

designed against: tissue-repair peptides in the corpus (actin-binding and matrix-signalling fragments) — 5 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 5 sequenced healing peptides in the corpus.
  • Sampled a 35-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.863.
  • Nearest known sequence is Thymosin β4 at normalised edit distance 0.698 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge -2 and mean hydropathy -1.12 both fall inside the class's observed ranges.

composition 0.863 · novelty 0.698 (nearest known: Thymosin β4) · charge in class range: yes · hydropathy in class range: yes

sha256 9839d67d39e13c20800667e53518ac5974449bdaf369442971e0b23d37d6faae

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C002

LKKTETIEQEKQAGLVQPGKPD

1. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L12. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Thr — Threonine · polar · hydropathy -0.7 · charge 0T5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. Thr — Threonine · polar · hydropathy -0.7 · charge 0T67. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I8. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E9. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q13. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A14. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G15. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L16. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V1617. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q18. Pro — Proline · proline · hydropathy -1.6 · charge 0P19. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G20. Lys — Lysine · positive · hydropathy -3.9 · charge +1K21. Pro — Proline · proline · hydropathy -1.6 · charge 0P2122. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D22
healing 22 residues 2438 Da computational score 0.829

designed against: tissue-repair peptides in the corpus (actin-binding and matrix-signalling fragments) — 5 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 5 sequenced healing peptides in the corpus.
  • Sampled a 22-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.890.
  • Nearest known sequence is TB-500 at normalised edit distance 0.682 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge 0 and mean hydropathy -1.25 both fall inside the class's observed ranges.

composition 0.89 · novelty 0.682 (nearest known: TB-500) · charge in class range: yes · hydropathy in class range: yes

sha256 bc96f27e9699f6b17326a73bb23cfd66f472291afac4a02bd14bf9929eccb7e2

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C003

LKKTETIEKQAGESQGTFTQE

1. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L12. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Thr — Threonine · polar · hydropathy -0.7 · charge 0T5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. Thr — Threonine · polar · hydropathy -0.7 · charge 0T67. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I8. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E9. Lys — Lysine · positive · hydropathy -3.9 · charge +1K10. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q11. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A1112. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G13. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E14. Ser — Serine · polar · hydropathy -0.8 · charge 0S15. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q16. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G1617. Thr — Threonine · polar · hydropathy -0.7 · charge 0T18. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F19. Thr — Threonine · polar · hydropathy -0.7 · charge 0T20. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q21. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E21
healing 21 residues 2354 Da computational score 0.76

designed against: tissue-repair peptides in the corpus (actin-binding and matrix-signalling fragments) — 5 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 5 sequenced healing peptides in the corpus.
  • Sampled a 21-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.733.
  • Nearest known sequence is TB-500 at normalised edit distance 0.667 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge -1 and mean hydropathy -1.32 both fall inside the class's observed ranges.

composition 0.733 · novelty 0.667 (nearest known: TB-500) · charge in class range: yes · hydropathy in class range: yes

sha256 e302b1994143dfe5d136b71eb70a2cbba081283d64b3ad4bca7e21e2a82b256f

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C004

LLGDFFRKRIKDFFRKRQQELDKWASLIHSLWNWFTSSEI

1. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L12. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L3. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D5. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F6. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F67. Arg — Arginine · positive · hydropathy -4.5 · charge +1R8. Lys — Lysine · positive · hydropathy -3.9 · charge +1K9. Arg — Arginine · positive · hydropathy -4.5 · charge +1R10. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D13. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F14. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F15. Arg — Arginine · positive · hydropathy -4.5 · charge +1R16. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1617. Arg — Arginine · positive · hydropathy -4.5 · charge +1R18. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q19. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q20. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E21. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2122. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D23. Lys — Lysine · positive · hydropathy -3.9 · charge +1K24. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W25. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A26. Ser — Serine · polar · hydropathy -0.8 · charge 0S2627. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L28. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I29. His — Histidine · positive · hydropathy -3.2 · charge 0H30. Ser — Serine · polar · hydropathy -0.8 · charge 0S31. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L3132. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W33. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N34. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W35. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F36. Thr — Threonine · polar · hydropathy -0.7 · charge 0T3637. Ser — Serine · polar · hydropathy -0.8 · charge 0S38. Ser — Serine · polar · hydropathy -0.8 · charge 0S39. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E40. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I40
immune 40 residues 5044 Da computational score 0.75

designed against: host-defence and immunomodulatory peptides in the corpus — 9 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 9 sequenced immune peptides in the corpus.
  • Sampled a 40-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.724.
  • Nearest known sequence is LL-37 at normalised edit distance 0.650 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge +3 and mean hydropathy -0.59 both fall inside the class's observed ranges.

composition 0.724 · novelty 0.65 (nearest known: LL-37) · charge in class range: yes · hydropathy in class range: yes

sha256 35ca9a3c18716617dcb6c446f2dc6ed84959ecdad4048f685ac0973daf76805b

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C005

YTSSEITTKDFFRKSGAVDTSLIHSLWNWFAYRKSQNQQE

1. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y12. Thr — Threonine · polar · hydropathy -0.7 · charge 0T3. Ser — Serine · polar · hydropathy -0.8 · charge 0S4. Ser — Serine · polar · hydropathy -0.8 · charge 0S5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Thr — Threonine · polar · hydropathy -0.7 · charge 0T9. Lys — Lysine · positive · hydropathy -3.9 · charge +1K10. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D11. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F1112. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F13. Arg — Arginine · positive · hydropathy -4.5 · charge +1R14. Lys — Lysine · positive · hydropathy -3.9 · charge +1K15. Ser — Serine · polar · hydropathy -0.8 · charge 0S16. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G1617. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A18. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V19. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D20. Thr — Threonine · polar · hydropathy -0.7 · charge 0T21. Ser — Serine · polar · hydropathy -0.8 · charge 0S2122. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L23. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I24. His — Histidine · positive · hydropathy -3.2 · charge 0H25. Ser — Serine · polar · hydropathy -0.8 · charge 0S26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W28. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N29. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W30. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F31. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3132. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y33. Arg — Arginine · positive · hydropathy -4.5 · charge +1R34. Lys — Lysine · positive · hydropathy -3.9 · charge +1K35. Ser — Serine · polar · hydropathy -0.8 · charge 0S36. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q3637. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N38. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q39. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q40. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E40
immune 40 residues 4771 Da computational score 0.804

designed against: host-defence and immunomodulatory peptides in the corpus — 9 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 9 sequenced immune peptides in the corpus.
  • Sampled a 40-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.761.
  • Nearest known sequence is CJC-1295 at normalised edit distance 0.750 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge +1 and mean hydropathy -0.87 both fall inside the class's observed ranges.

composition 0.761 · novelty 0.75 (nearest known: CJC-1295) · charge in class range: yes · hydropathy in class range: yes

sha256 b5ef9c9f2e510b69cef7aa61b2f695005b0753fce65a9a42a2c7e30ad77369f4

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C006

SDAAVDTSSEITTGLPGTCGLPGTCLKSGAICHPV

1. Ser — Serine · polar · hydropathy -0.8 · charge 0S12. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D3. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A4. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A5. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V6. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Ser — Serine · polar · hydropathy -0.8 · charge 0S9. Ser — Serine · polar · hydropathy -0.8 · charge 0S10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I1112. Thr — Threonine · polar · hydropathy -0.7 · charge 0T13. Thr — Threonine · polar · hydropathy -0.7 · charge 0T14. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G15. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L16. Pro — Proline · proline · hydropathy -1.6 · charge 0P1617. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G18. Thr — Threonine · polar · hydropathy -0.7 · charge 0T19. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C20. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G21. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2122. Pro — Proline · proline · hydropathy -1.6 · charge 0P23. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G24. Thr — Threonine · polar · hydropathy -0.7 · charge 0T25. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Lys — Lysine · positive · hydropathy -3.9 · charge +1K28. Ser — Serine · polar · hydropathy -0.8 · charge 0S29. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G30. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A31. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I3132. Cys — Cysteine · cysteine · hydropathy 2.5 · charge 0C33. His — Histidine · positive · hydropathy -3.2 · charge 0H34. Pro — Proline · proline · hydropathy -1.6 · charge 0P35. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V35
immune 35 residues 3360 Da computational score 0.731

designed against: host-defence and immunomodulatory peptides in the corpus — 9 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 9 sequenced immune peptides in the corpus.
  • Sampled a 35-residue candidate inside that class's observed length range (6–40).
  • Residue composition matches the class centroid at cosine 0.728.
  • Nearest known sequence is Thymosin α1 at normalised edit distance 0.600 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge -2 and mean hydropathy 0.30 both fall inside the class's observed ranges.

composition 0.728 · novelty 0.6 (nearest known: Thymosin α1) · charge in class range: yes · hydropathy in class range: yes

sha256 f00089fcf9f84a035b167df750c63b3b280077bcb4f3cb534173c5ea62f29489

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C007

EDGSFR

1. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E12. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D3. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4. Ser — Serine · polar · hydropathy -0.8 · charge 0S5. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F6. Arg — Arginine · positive · hydropathy -4.5 · charge +1R6
longevity 6 residues 710 Da computational score 0.66

designed against: short geroprotective regulatory peptides in the corpus — 3 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 3 sequenced longevity peptides in the corpus.
  • Sampled a 6-residue candidate inside that class's observed length range (6–4).
  • Residue composition matches the class centroid at cosine 0.650.
  • Nearest known sequence is Pinealon at normalised edit distance 0.500 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge -1 and mean hydropathy -1.65 both fall inside the class's observed ranges.

composition 0.65 · novelty 0.5 (nearest known: Pinealon) · charge in class range: yes · hydropathy in class range: yes

sha256 1fee88d0b9ced962d2389e59a4e99736ca21bf43f01b2475b2e14f9393c6f383

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C008

EDGSFR

1. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E12. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D3. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4. Ser — Serine · polar · hydropathy -0.8 · charge 0S5. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F6. Arg — Arginine · positive · hydropathy -4.5 · charge +1R6
longevity 6 residues 710 Da computational score 0.66

designed against: short geroprotective regulatory peptides in the corpus — 3 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 3 sequenced longevity peptides in the corpus.
  • Sampled a 6-residue candidate inside that class's observed length range (6–4).
  • Residue composition matches the class centroid at cosine 0.650.
  • Nearest known sequence is Pinealon at normalised edit distance 0.500 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge -1 and mean hydropathy -1.65 both fall inside the class's observed ranges.

composition 0.65 · novelty 0.5 (nearest known: Pinealon) · charge in class range: yes · hydropathy in class range: yes

sha256 1fee88d0b9ced962d2389e59a4e99736ca21bf43f01b2475b2e14f9393c6f383

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C009

MAPRKLRIVQQEMGYIFYP

1. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M12. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3. Pro — Proline · proline · hydropathy -1.6 · charge 0P4. Arg — Arginine · positive · hydropathy -4.5 · charge +1R5. Lys — Lysine · positive · hydropathy -3.9 · charge +1K6. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L67. Arg — Arginine · positive · hydropathy -4.5 · charge +1R8. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I9. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V10. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q11. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q1112. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E13. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M14. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G15. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y16. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I1617. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F18. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y19. Pro — Proline · proline · hydropathy -1.6 · charge 0P19
mitochondrial 19 residues 2341 Da computational score 0.789

designed against: mitochondrial-derived peptides in the corpus — 2 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 2 sequenced mitochondrial peptides in the corpus.
  • Sampled a 19-residue candidate inside that class's observed length range (16–24).
  • Residue composition matches the class centroid at cosine 0.842.
  • Nearest known sequence is MOTS-c at normalised edit distance 0.632 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge +2 and mean hydropathy -0.22 both fall inside the class's observed ranges.

composition 0.842 · novelty 0.632 (nearest known: MOTS-c) · charge in class range: yes · hydropathy in class range: yes

sha256 db6ad6c1ec7aa1705577330a114a7591d2842d27c04f7ca8a7c9e364cfac781c

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C010

MAPRKLRISWIKDFIEWLKNGG

1. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M12. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3. Pro — Proline · proline · hydropathy -1.6 · charge 0P4. Arg — Arginine · positive · hydropathy -4.5 · charge +1R5. Lys — Lysine · positive · hydropathy -3.9 · charge +1K6. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L67. Arg — Arginine · positive · hydropathy -4.5 · charge +1R8. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I9. Ser — Serine · polar · hydropathy -0.8 · charge 0S10. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W11. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I1112. Lys — Lysine · positive · hydropathy -3.9 · charge +1K13. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D14. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F15. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I16. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E1617. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W18. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L19. Lys — Lysine · positive · hydropathy -3.9 · charge +1K20. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N21. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G2122. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G22
mitochondrial 22 residues 2659 Da computational score 0.796

designed against: mitochondrial-derived peptides in the corpus — 2 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 2 sequenced mitochondrial peptides in the corpus.
  • Sampled a 22-residue candidate inside that class's observed length range (16–24).
  • Residue composition matches the class centroid at cosine 0.780.
  • Nearest known sequence is Semaglutide at normalised edit distance 0.710 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge +3 and mean hydropathy -0.39 both fall inside the class's observed ranges.

composition 0.78 · novelty 0.71 (nearest known: Semaglutide) · charge in class range: yes · hydropathy in class range: yes

sha256 6c1a20d3c5e95e597ebcc8731a4df966a3f642615da88649a69031e0150b4c5a

registry entry →

COMPUTATIONAL CANDIDATE — NOT VALIDATED, NOT SYNTHESISED, NOT FOR HUMAN USE

BLLM-C011

MAPRKLRNLISDAIFYPR

1. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M12. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3. Pro — Proline · proline · hydropathy -1.6 · charge 0P4. Arg — Arginine · positive · hydropathy -4.5 · charge +1R5. Lys — Lysine · positive · hydropathy -3.9 · charge +1K6. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L67. Arg — Arginine · positive · hydropathy -4.5 · charge +1R8. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N9. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L10. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I11. Ser — Serine · polar · hydropathy -0.8 · charge 0S1112. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D13. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A14. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I15. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F16. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y1617. Pro — Proline · proline · hydropathy -1.6 · charge 0P18. Arg — Arginine · positive · hydropathy -4.5 · charge +1R18
mitochondrial 18 residues 2162 Da computational score 0.797

designed against: mitochondrial-derived peptides in the corpus — 2 indexed sequences.

reasoning trace
  • Built an order-2 residue Markov model from the 2 sequenced mitochondrial peptides in the corpus.
  • Sampled a 18-residue candidate inside that class's observed length range (16–24).
  • Residue composition matches the class centroid at cosine 0.868.
  • Nearest known sequence is Humanin at normalised edit distance 0.625 — above the 0.5 novelty floor, and not a substring of any indexed peptide.
  • Net charge +3 and mean hydropathy -0.27 both fall inside the class's observed ranges.

composition 0.868 · novelty 0.625 (nearest known: Humanin) · charge in class range: yes · hydropathy in class range: yes

sha256 e854517a9a39b4f583e32668a9110f04adae8e7287a955ac0504d94084e5877a

registry entry →

The queue