database / hormone
Kisspeptin-10
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 25240297. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
YNWNSFGLRF
Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide; the RF-amide motif is required for receptor activation.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C63H83N17O14 |
|---|---|
| molecular weight | 1302.4 Da (PubChem) |
| computed backbone mass | 1303.44 Da |
| length | 10 residues |
| net charge (pH 7.4) | +1 |
| mean hydropathy | -0.55 |
| half-life | not characterised |
| delivery route | intravenous, subcutaneous |
| PubChem CID | 25240297 |
| PDB | not characterised |
| UniProt parent | Q15726 |
Mechanism
KISS1R agonist upstream of GnRH release.
Reported targets: KISS1R
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Position in the parent protein
…APHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG
Parent sequence from UniProt Q15726. Kisspeptin-10 is the shortest active C-terminal fragment of KISS1.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| LH release in trials | Chronic subcutaneous kisspeptin-10 stimulates gonadotropin secretion for 12 … European journal of endocrinology 2026 |
| reproductive-axis activation | Kisspeptin-10 attenuates pulmonary arterial hypertension via restoration of … Neuropeptides 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT02514629 | Testosterone, Metformin, or Both, for Hypogonadism in Obese Males | COMPLETED | PHASE3 |
| NCT01952782 | Neuropeptides in Human Reproduction | COMPLETED | PHASE1 |
| NCT05971836 | The Molecular Basis of Inherited Reproductive Disorders | COMPLETED | — |
| NCT02369796 | A Phase 2a Pharmacodynamic Study of TAK-448 in Participants With Hypogonadotropic Hypogonadi | TERMINATED | PHASE2 |
| NCT07224438 | Kisspeptin Administration Subcutaneously to Patients With Hypothalamic Amenorrhea | RECRUITING | PHASE2 |
Literature (8)
Chronic subcutaneous kisspeptin-10 stimulates gonadotropin secretion for 12 days in healthy men — European journal of endocrinology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42549827 · DOI 10.1093/ejendo/lvag134
Kisspeptin-10 attenuates pulmonary arterial hypertension via restoration of mitochondrial function in pulmonary artery smooth muscle cells — Neuropeptides 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41955717 · DOI 10.1016/j.npep.2026.102611
Kisspeptin Restores Placental mTOR Signaling and Improves Glucose Homeostasis Mediators Disrupted by Maternal Hypothyroidism in Rats — Acta physiologica (Oxford, England) 2026
AimReduced placental mTOR signaling is associated with intrauterine growth restriction and impaired maternal and placental metabolism. Since maternal hypothyroidism induces intrauterine growth restriction, and maternal treatment with kisspeptin-10 (Kp10) has been shown to improve feto-placental development in hypothyroid rats, this study aimed to evaluate the effects of maternal hypothyroidism, with and without kisspeptin-10 treatment, on maternal energy homeostasis and placental expression of mTOR and glucose metabolism mediators.MethodsMaternal hypothyroidism was induced by administration of propylthiouracil, and kisspeptin-10 treatment began on gestational day 8.ResultsMaternal hypothyroidism caused glucose intolerance, decreased insulin and HDL levels, reduced fetal and placental weights, and thinned the placental interhaemal barrier. It also increased INSRβ and AKT, while downregula…
open access ↗ · PMID 41782211 · DOI 10.1111/apha.70188
Kisspeptin-10 Ameliorates Obesity-Diabetes with Diverse Effects on Ileal Enteroendocrine Cells and Pancreatic Islet Morphology in High-Fat Fed Female Mice — Biomolecules 2025
Kisspeptin is a neuropeptide recognised for a pivotal role within the reproductive system, but potentially important endocrine metabolic effects are less well understood. We examined effects of twice-daily intraperitoneal administration of saline vehicle or kisspeptin-10 ([dose redacted]), for 21 days, on glucose homeostasis, energy balance, circulating hormones as well as the morphology-function of enteroendocrine and islet cells in high-fat diet (HFD) fed female mice, with normal diet (ND) mice as an additional control group. Kisspeptin-10 decreased body weight, blood glucose and energy intake to ND levels. HFD increased circulating follicle-stimulating hormone (FSH) levels, which were further enhanced by kisspeptin-10 along with luteinising hormone (LH) concentrations. Neither HFD nor kisspeptin-10 affected progesterone or corticosterone. In the ileum, kisspeptin-10 decreased crypt depth a…
open access ↗ · PMID 41301510 · DOI 10.3390/biom15111591
Integrated transcriptomics and miRNA-mRNA network analysis reveals Kisspeptin-10 mediated regulation of EMT and apoptosis in glioblastoma — Computational biology and chemistry 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41389577 · DOI 10.1016/j.compbiolchem.2025.108826
Exogenous Kisspeptin-10 inhibits ovarian cancer progression through targeting the SP1-hTERT-ZEB1 regulatory axis — Cytotechnology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42292313 · DOI 10.1007/s10616-026-01005-8
Kisspeptin-10 regulates glycosaminoglycan and decorin content in human cardiac fibroblast cultures — Pharmacological reports : PR 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42159865 · DOI 10.1007/s43440-026-00870-6
Exogenous kisspeptin-10 treatment shows pleiotropy via induction of KISS1 expression, metastasis suppression, and promotes apoptosis in triple-negative breast cancer — Scientific reports 2025
Triple-negative breast cancer (TNBC) is an aggressive subtype lacking ER, PR, and HER2 receptors making it highly clinically challenging subtype pf breast cancer. In this study, we investigated the effect of exogenous Kisspeptin-10 (Kp-10), on MDA-MB-231 and MDA-MB-468 cells. TNBC cells using both in vitro and in silico approaches. Kp-10 treatment significantly reduced cell viability and migration and induced a dose-dependent upregulation of KISS1 mRNA, suggesting a positive feedback loop. Alongside this, Kp-10 modulated key transcription factors-upregulating GATA2, CDX2, and FLI1 while downregulating ZEB1-indicating a shift towards a less aggressive transcriptional state. EMT reversal was evident from increased E-cadherin and β-catenin, and reduced N-cadherin, CD44, and Vimentin. Pro-apoptotic genes CASP3, CASP8, CASP9, and BAX were upregulated, while BCL2 was suppressed, suggesting act…
open access ↗ · PMID 41062590 · DOI 10.1038/s41598-025-19140-1
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Insulin
hormone · 8 citations