biohacking$bioLLM CA: TBA

database / hormone

Ghrelin

research compound hormone endocrinemetabolicnervous modified — mass check n/a

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

GSSFLSPEHQRVQQRKESKKPPAKLQPR

Gly-Ser-Ser-Phe-Leu-Ser-Pro-Glu-His-Gln-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro-Arg

1. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G12. Ser — Serine · polar · hydropathy -0.8 · charge 0S3. Ser — Serine · polar · hydropathy -0.8 · charge 0S4. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F5. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L6. Ser — Serine · polar · hydropathy -0.8 · charge 0S67. Pro — Proline · proline · hydropathy -1.6 · charge 0P8. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E9. His — Histidine · positive · hydropathy -3.2 · charge 0H10. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q11. Arg — Arginine · positive · hydropathy -4.5 · charge +1R1112. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V13. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q14. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q15. Arg — Arginine · positive · hydropathy -4.5 · charge +1R16. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1617. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E18. Ser — Serine · polar · hydropathy -0.8 · charge 0S19. Lys — Lysine · positive · hydropathy -3.9 · charge +1K20. Lys — Lysine · positive · hydropathy -3.9 · charge +1K21. Pro — Proline · proline · hydropathy -1.6 · charge 0P2122. Pro — Proline · proline · hydropathy -1.6 · charge 0P23. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A24. Lys — Lysine · positive · hydropathy -3.9 · charge +1K25. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L26. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q2627. Pro — Proline · proline · hydropathy -1.6 · charge 0P28. Arg — Arginine · positive · hydropathy -4.5 · charge +1R28

Modified molecule. Ser3 is octanoylated by GOAT; the acyl group is required for receptor activation.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulanot characterised
molecular weight3244.71 Da (computed from sequence)
computed backbone mass3244.71 Da
length28 residues
net charge (pH 7.4)+5
mean hydropathy-1.68
half-lifenot characterised
delivery routenot characterised
PubChem CIDnot characterised
PDBnot characterised
UniProt parentQ9UBU3

Mechanism

Endogenous GHS-R1a agonist; the hunger hormone.

Reported targets: GHS-R1a

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 24–51 of Appetite-regulating hormone (117 aa)

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVR…

Parent sequence from UniProt Q9UBU3. Ghrelin and obestatin derive from the same precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
GH releaseAlcohol Exposure Alters the Ghrelin System: In Vitro Mechanistic Insights In… Alcohol, clinical & experimental research 2026
appetite stimulationLactobacillus paragasseri OLL2716 Promotes Ghrelin Expression in Gastric Cel… Probiotics and antimicrobial proteins 2026

Literature (8)

Alcohol Exposure Alters the Ghrelin System: In Vitro Mechanistic Insights Into Impaired Glucose Sensing and Enhanced Ghrelin Secretion — Alcohol, clinical & experimental research 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42552663 · DOI 10.1111/acer.70392

Lactobacillus paragasseri OLL2716 Promotes Ghrelin Expression in Gastric Cells — Probiotics and antimicrobial proteins 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42593614 · DOI 10.1007/s12602-026-11172-x

Targeting the leptin-ghrelin axis for obesity management: Mechanistic insights and therapeutic approaches — Prostaglandins & other lipid mediators 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42462482 · DOI 10.1016/j.prostaglandins.2026.107093

Preliminary investigation of ghrelin in horses and ponies: receptor expression and associations with prandial state, morphometry and signalment — BMC veterinary research 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42426797 · DOI 10.1186/s12917-026-05700-8

Nicotinic acetylcholine receptors and their role in ghrelin-producing cells — Biochemical and biophysical research communications 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42269270 · DOI 10.1016/j.bbrc.2026.154114

Activation of GHSRs Facilitates the Excitability of Dentate Gyrus Granule Cells and Short-Term Spatial Memory via Multiple Ionic and Signaling Mechanisms — Advanced biology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42552604 · DOI 10.1002/adbi.70145

Food anticipation, ghrelin and anxiety in juvenile goldfish: evidence for a mesolimbic dopaminergic link? — The Journal of experimental biology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42165603 · DOI 10.1242/jeb.252553

Altered responses to ghrelin and food cues in AgRP neurons during pregnancy and lactation — Journal of neuroendocrinology 2026

Pregnancy and lactation trigger many metabolic adaptations, including increased food intake to support the energy demands of the growing foetus and then to provide nutrition through milk production after birth. Ghrelin, an orexigenic hormone, activates agouti related peptide (AgRP) neurons in the arcuate nucleus to promote food intake. Here, we investigated the hypothesis that increased sensitivity to ghrelin during pregnancy and lactation may contribute to elevated maternal food intake. Acute food intake was measured after a single dose of ghrelin or vehicle across reproductive states including virgin, pregnant (Day 8 and Day 15), lactating (Day 10) mice and dams 2 weeks after weaning. In vivo GCaMP fibre photometry of the AgRP neuron population was used to measure AgRP neuronal response to ghrelin. Unlike virgin mice, pregnant mice did not show an acute increase in food intake after gh…

open access ↗ · PMID 42265978 · DOI 10.1111/jne.70202

Related

Glucagon

hormone · 8 citations

Ipamorelin

gh-secretagogue · 8 citations

GHRP-2

gh-secretagogue · 8 citations

GHRP-6

gh-secretagogue · 7 citations

Hexarelin

gh-secretagogue · 8 citations

Oxytocin

hormone · 8 citations