biohacking$bioLLM CA: TBA

defensive publication

Published, timestamped, open

This registry is a public, timestamped disclosure. Each sequence is published in full, with the date it was proposed and a hash anyone can recompute — the standard shape of a defensive publication, which is how disclosed material enters the public record and becomes citable prior art.

No patent has been filed on any sequence here, and none will be. What this registry does is publish and timestamp. What any particular disclosure would do to a specific later patent application is a question for a patent attorney and a patent office, and this page does not answer it.

The ledger

Each hash is the SHA-256 of the candidate's sequence string, exactly as published. Anyone can recompute it.
idsequenceclassproposedsha-256on-chain anchor
BLLM-C001 LKKTETIEQEKQAGLVQPGKPDMAEIEKQAGEPPG healing 2026-09-01 9839d67d39e13c20800667e53518ac5974449bdaf369442971e0b23d37d6faae anchoring begins at launch
BLLM-C002 LKKTETIEQEKQAGLVQPGKPD healing 2026-09-01 bc96f27e9699f6b17326a73bb23cfd66f472291afac4a02bd14bf9929eccb7e2 anchoring begins at launch
BLLM-C003 LKKTETIEKQAGESQGTFTQE healing 2026-09-01 e302b1994143dfe5d136b71eb70a2cbba081283d64b3ad4bca7e21e2a82b256f anchoring begins at launch
BLLM-C004 LLGDFFRKRIKDFFRKRQQELDKWASLIHSLWNWFTSSEI immune 2026-09-01 35ca9a3c18716617dcb6c446f2dc6ed84959ecdad4048f685ac0973daf76805b anchoring begins at launch
BLLM-C005 YTSSEITTKDFFRKSGAVDTSLIHSLWNWFAYRKSQNQQE immune 2026-09-01 b5ef9c9f2e510b69cef7aa61b2f695005b0753fce65a9a42a2c7e30ad77369f4 anchoring begins at launch
BLLM-C006 SDAAVDTSSEITTGLPGTCGLPGTCLKSGAICHPV immune 2026-09-01 f00089fcf9f84a035b167df750c63b3b280077bcb4f3cb534173c5ea62f29489 anchoring begins at launch
BLLM-C007 EDGSFR longevity 2026-09-01 1fee88d0b9ced962d2389e59a4e99736ca21bf43f01b2475b2e14f9393c6f383 anchoring begins at launch
BLLM-C008 EDGSFR longevity 2026-09-01 1fee88d0b9ced962d2389e59a4e99736ca21bf43f01b2475b2e14f9393c6f383 anchoring begins at launch
BLLM-C009 MAPRKLRIVQQEMGYIFYP mitochondrial 2026-09-01 db6ad6c1ec7aa1705577330a114a7591d2842d27c04f7ca8a7c9e364cfac781c anchoring begins at launch
BLLM-C010 MAPRKLRISWIKDFIEWLKNGG mitochondrial 2026-09-01 6c1a20d3c5e95e597ebcc8731a4df966a3f642615da88649a69031e0150b4c5a anchoring begins at launch
BLLM-C011 MAPRKLRNLISDAIFYPR mitochondrial 2026-09-01 e854517a9a39b4f583e32668a9110f04adae8e7287a955ac0504d94084e5877a anchoring begins at launch

Verify it yourself

Take any sequence from the table and hash it. You should get the value in the ledger:

printf '%s' 'LKKTETIEQEKQAGLVQPGKPD' | shasum -a 256

No trust required — that is the point of publishing a hash rather than asserting one.

How anchoring will work

At launch, each hash is written into the calldata of a transaction on Robinhood Chain from the project address, and the resulting transaction hash is recorded in the anchor column above. That gives every sequence a timestamp anyone can check against the chain, independent of this website continuing to exist.

Until a transaction actually exists, the anchor column says so. There are no placeholder transaction hashes on this page, because a fake anchor would defeat the entire mechanic.