Teriparatide

also known as PTH (1-34), Forteo

approved hormone musculoskeletalendocrine mass-verified

289 heavy atoms · 585 bonds · drag to pan, scroll to zoom C181N55O51S2

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16133850. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Computed backbone mass 4117.76 Da agrees with PubChem's reported 4118 Da (Δ 0.24 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C181H291N55O51S2
molecular weight	4118 Da (PubChem)
computed backbone mass	4117.76 Da
length	34 residues
net charge (pH 7.4)	+1
mean hydropathy	-0.67
half-life	not characterised
delivery route	subcutaneous
PubChem CID	16133850
PDB	not characterised
UniProt parent	P01270

Mechanism

PTH1R agonist; intermittent exposure drives bone formation.

Reported targets: PTH1R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 32–65 of Parathyroid hormone (115 aa)

…AKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNV…

Parent sequence from UniProt P01270. Residues 1-34 of human PTH.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
bone mineral density outcomes in trials	Mechanisms limiting the long-term anabolic effects of teriparatide (PTH 1-34… JBMR plus 2026
fracture-risk outcomes in trials	Teriparatide Therapy in Children with Hypoparathyroidism: A Systematic Revie… Calcified tissue international 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT04974723	Real-world Effectiveness and Cardiovascular Safety Study of Abaloparatide in Postmenopausal	COMPLETED	—
NCT01078805	Study of FORTEO Use in Subjects in the Community Setting	COMPLETED	—
NCT04126941	Monocentric Study on the Use of Teriparatide in Children With hypoparathyroïdism	UNKNOWN	—
NCT00361595	Intervenous (IV) Zoledronic Acid After Forteo in Postmenopausal Women	COMPLETED	NA
NCT02091492	Teriparatide for Fracture Repair in Humans	WITHDRAWN	PHASE3

Literature (8)

Mechanisms limiting the long-term anabolic effects of teriparatide (PTH 1-34) on bone — JBMR plus 2026

Teriparatide, (recombinant human PTH 1-34) is an Food and Drug Administration (FDA)-approved anabolic therapy for osteoporosis. In patients with severe bone loss, daily teriparatide injections increase osteoblastic activity and bone turnover, leading to net gain in bone mass, increased BMD, and significantly reduced fracture risk. However, after 6-12 mo of treatment, its anabolic effects, reflected by increased serum bone turnover markers and LS-BMD gain, tend to diminish. Despite various efforts to address this challenge, the underlying mechanisms have remained poorly understood. This review discusses the main mechanisms proposed to limit teriparatide's bone anabolic potential, including osteoprogenitor depletion, changes in bone remodeling dynamics, counter-regulatory molecules (eg, Wnt inhibitors), the influence of mechanical loading, and downstream signaling adaptations. Understandin…

open access ↗ · PMID 42306552 · DOI 10.1093/jbmrpl/ziag093

Teriparatide Therapy in Children with Hypoparathyroidism: A Systematic Review and Meta-Analysis — Calcified tissue international 2026