database / hormone
Substance P
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 36511. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
RPKPQQFFGLM
Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C63H98N18O13S |
|---|---|
| molecular weight | 1347.6 Da (PubChem) |
| computed backbone mass | 1348.63 Da |
| length | 11 residues |
| net charge (pH 7.4) | +2 |
| mean hydropathy | -0.7 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 36511 |
| PDB | not characterised |
| UniProt parent | P20366 |
Mechanism
Tachykinin NK1 receptor agonist; a principal nociceptive and inflammatory neuropeptide.
Reported targets: NK1R
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Position in the parent protein
…WYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQ…
Parent sequence from UniProt P20366. Substance P is a protachykinin-1 cleavage product.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| nociceptive signalling | Broadening the View: Substance P and Its Metabolism in Pruritus-Related Dise… The Journal of dermatology 2026 |
| neurogenic inflammation | Weekly electroejaculation did not negatively affect substance P and temperam… American journal of veterinary research 2026 |
Literature (8)
Broadening the View: Substance P and Its Metabolism in Pruritus-Related Diseases — The Journal of dermatology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42244108 · DOI 10.1111/1346-8138.70328
Weekly electroejaculation did not negatively affect substance P and temperament scoring in young bulls — American journal of veterinary research 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42468553 · DOI 10.2460/ajvr.26.05.0235
Change in Swallowing Function and Substance P Levels Associated with Nicergoline in Neurological Disease: A Pilot Study — Journal of clinical medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42355896 · DOI 10.3390/jcm15124728
Change in Swallowing Function and Substance P Levels Associated with Nicergoline in Neurological Disease: A Pilot Study — Journal of clinical medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
Immunohistochemical analysis of substance P from cerebral ganglion of S. maculata and B. bengalensis — Research Square 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.21203/rs.3.rs-9908743/v1
Correction to "Substance P and NK-1R in Dengue: A First Serological Investigation" — Health science reports 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42591736 · DOI 10.1002/hsr2.73048
Salivary Substance P Levels During Cesarean Section Under Spinal versus General Anesthesia: A Prospective Study — Journal of pain research 2026
BackgroundSubstance P is a key neuropeptide involved in the transmission of nociceptive (pain) signals. The choice of anesthesia for childbirth, particularly for cesarean section (CS), is a critical decision that directly impacts the mother's physiological response to the procedure. This study aims to compare the levels of salivary SP in pregnant women undergoing CS under spinal versus general anesthesia.MethodsEighty-three patients participated in this prospective comparative study. They were categorized into two groups: general and spinal anesthesia groups. The primary outcome was to measure the mean difference in salivary substance P level at three different time points of CS, and to compare these values between both groups. The secondary outcome was to assess the factors affecting the substance P levels in the mothers.ResultsThe study included 44 (53%) who received spinal anesthesia …
open access ↗ · PMID 42088763 · DOI 10.2147/jpr.s584688
Striatum regulates the cortex via the basal forebrain cholinergic system: A role for substance P — Trends in neurosciences 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42392894 · DOI 10.1016/j.tins.2026.06.007
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations