biohacking$bioLLM CA: TBA

database / incretin

Semaglutide

also known as Ozempic, Wegovy, Rybelsus

approved incretin metabolicendocrinecardiovascular modified — mass check n/a
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
291 heavy atoms · 587 bonds · drag to pan, scroll to zoom C187O59N45

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 56843331. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly

1. His — Histidine · positive · hydropathy -3.2 · charge 0H12. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A3. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E4. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G5. Thr — Threonine · polar · hydropathy -0.7 · charge 0T6. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F67. Thr — Threonine · polar · hydropathy -0.7 · charge 0T8. Ser — Serine · polar · hydropathy -0.8 · charge 0S9. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D10. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V11. Ser — Serine · polar · hydropathy -0.8 · charge 0S1112. Ser — Serine · polar · hydropathy -0.8 · charge 0S13. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y14. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L15. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E16. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G1617. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q18. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A19. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A20. Lys — Lysine · positive · hydropathy -3.9 · charge +1K21. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E2122. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F23. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I24. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A25. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V28. Arg — Arginine · positive · hydropathy -4.5 · charge +1R29. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G30. Arg — Arginine · positive · hydropathy -4.5 · charge +1R31. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G31

Modified molecule. Aib substituted at position 8 and a C18 diacid conjugated via a γGlu-2×AEEA linker at Lys26 — the backbone shown is the GLP-1(7-37) analogue scaffold, not the complete conjugate.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC187H291N45O59
molecular weight4114 Da (PubChem)
computed backbone mass3383.72 Da
length31 residues
net charge (pH 7.4)-1
mean hydropathy-0.25
half-lifenot characterised
delivery routesubcutaneous, oral
PubChem CID56843331
PDBnot characterised
UniProt parentnot characterised

Mechanism

GLP-1 receptor agonist; the acyl chain drives albumin binding and extends circulating half-life.

Reported targets: GLP-1R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
weight lossHypoglycaemic coma induced by a falsified semaglutide product: a case report European journal of hospital pharmacy : science and practice 2026
glycaemic controlThe Ethics of Ozempic and Wegovy Journal of medical ethics 2026
appetite suppressionIschemic optic neuropathy with semaglutide: global observational analysis of… The British journal of ophthalmology 2026
cardiovascular outcomesEthical considerations for semaglutide use in children Archives of disease in childhood 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT07779343OBESIAL: A Prospective Interventional Real-world Study of a Multidisciplinary Obesity ManageRECRUITINGNA
NCT06830343The Safety, Tolerability, and Pharmacokinetics of of SYH9017 in Chinese Participants With OvRECRUITINGPHASE1
NCT05232708A Clinical Trial Looking at the Comparability of 2 Different Forms of SemaglutideCOMPLETEDPHASE1
NCT07570810Efficacy, Safety, and Tolerability of CS0159 Combined With Semaglutide in MAFLD Patients WitNOT_YET_RECRUITINGNA
NCT05236517A Research Study Looking at How 50 mg Semaglutide Daily Affects Food Intake and Emptying of COMPLETEDPHASE1

Literature (8)

Hypoglycaemic coma induced by a falsified semaglutide product: a case report — European journal of hospital pharmacy : science and practice 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41125326 · DOI 10.1136/ejhpharm-2025-004656

The Ethics of Ozempic and Wegovy — Journal of medical ethics 2026

Semaglutide, sold under the brand names of Ozempic, Rybelsus and Wegovy, is one of the most popular drugs on the market. Manufactured by Novo Nordisk, semaglutide is the newest in a family of glucagon-like peptide-1 receptor agonists used most commonly to treat type II diabetes. To date, the results of semaglutide for the treatment of type II diabetes have been overwhelmingly positive. It is for the drug's effects on appetite suppression and weight loss, however, that have led its surge in popularity, with many hailing semaglutide as the new 'miracle drug for weight loss'. Despite its popularity, both the governmental and popular reception to the drug has largely been mixed. In this paper, we address a range of ethical concerns and argue that while many are legitimate, they do not provide conclusive reason not to prescribe semaglutide for weight loss.

open access ↗ · PMID 39848681 · DOI 10.1136/jme-2024-110374

Ischemic optic neuropathy with semaglutide: global observational analysis of sex- and formulation-specific risk — The British journal of ophthalmology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41807083 · DOI 10.1136/bjo-2025-328483

Ethical considerations for semaglutide use in children — Archives of disease in childhood 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41494820 · DOI 10.1136/archdischild-2025-329747

Semaglutide-induced transient intestinal ischemia: A case report — International journal of clinical pharmacology and therapeutics 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41467632 · DOI 10.5414/cp204861

The ethics of Wegovy: promoting autonomy in pediatric care — Medicine, health care, and philosophy 2026

Semaglutide, marketed as Wegovy, Ozempic, and Rybelsus, is a glucagon-like peptide-1 receptor agonist (GLP-1 RA) that has attracted significant global attention for its appetite-suppressing and weight-loss effects. Approved for pediatric use in children aged 12 and older, Wegovy has been described as a "miracle drug" and hailed as a potential solution to the so-called "obesity epidemic." However, prescribing medication to children raises complex ethical questions, including how best to respect young patients' autonomy and promote their well-being. This paper focuses on one such concern: the "argument from virtue." According to this view, Wegovy represents a morally problematic approach to weight loss because it circumvents the development of character traits-such as self-control and resilience-that are seen as integral to autonomy. We critically examine this argument, rejecting the claim…

open access ↗ · PMID 41065944 · DOI 10.1007/s11019-025-10300-8

Doctor who prescribed Ozempic and Wegovy to her partner has suspension extended — BMJ (Clinical research ed.) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42608058 · DOI 10.1136/bmj-2026-100590

Changes in Semaglutide Fills Following Expanded FDA and Medicare Policies — The American journal of managed care 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42640207 · DOI 10.37765/ajmc.2026.89983

Related

Tirzepatide

incretin · 8 citations

Retatrutide

incretin · 8 citations

Liraglutide

incretin · 8 citations

Exenatide

incretin · 8 citations

GLP-1 (7-37)

incretin · 8 citations

GIP

incretin · 8 citations