database / incretin
Semaglutide
also known as Ozempic, Wegovy, Rybelsus
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 56843331. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. Aib substituted at position 8 and a C18 diacid conjugated via a γGlu-2×AEEA linker at Lys26 — the backbone shown is the GLP-1(7-37) analogue scaffold, not the complete conjugate.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C187H291N45O59 |
|---|---|
| molecular weight | 4114 Da (PubChem) |
| computed backbone mass | 3383.72 Da |
| length | 31 residues |
| net charge (pH 7.4) | -1 |
| mean hydropathy | -0.25 |
| half-life | not characterised |
| delivery route | subcutaneous, oral |
| PubChem CID | 56843331 |
| PDB | not characterised |
| UniProt parent | not characterised |
Mechanism
GLP-1 receptor agonist; the acyl chain drives albumin binding and extends circulating half-life.
Reported targets: GLP-1R
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| weight loss | Hypoglycaemic coma induced by a falsified semaglutide product: a case report European journal of hospital pharmacy : science and practice 2026 |
| glycaemic control | The Ethics of Ozempic and Wegovy Journal of medical ethics 2026 |
| appetite suppression | Ischemic optic neuropathy with semaglutide: global observational analysis of… The British journal of ophthalmology 2026 |
| cardiovascular outcomes | Ethical considerations for semaglutide use in children Archives of disease in childhood 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT07779343 | OBESIAL: A Prospective Interventional Real-world Study of a Multidisciplinary Obesity Manage | RECRUITING | NA |
| NCT06830343 | The Safety, Tolerability, and Pharmacokinetics of of SYH9017 in Chinese Participants With Ov | RECRUITING | PHASE1 |
| NCT05232708 | A Clinical Trial Looking at the Comparability of 2 Different Forms of Semaglutide | COMPLETED | PHASE1 |
| NCT07570810 | Efficacy, Safety, and Tolerability of CS0159 Combined With Semaglutide in MAFLD Patients Wit | NOT_YET_RECRUITING | NA |
| NCT05236517 | A Research Study Looking at How 50 mg Semaglutide Daily Affects Food Intake and Emptying of | COMPLETED | PHASE1 |
Literature (8)
Hypoglycaemic coma induced by a falsified semaglutide product: a case report — European journal of hospital pharmacy : science and practice 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41125326 · DOI 10.1136/ejhpharm-2025-004656
The Ethics of Ozempic and Wegovy — Journal of medical ethics 2026
Semaglutide, sold under the brand names of Ozempic, Rybelsus and Wegovy, is one of the most popular drugs on the market. Manufactured by Novo Nordisk, semaglutide is the newest in a family of glucagon-like peptide-1 receptor agonists used most commonly to treat type II diabetes. To date, the results of semaglutide for the treatment of type II diabetes have been overwhelmingly positive. It is for the drug's effects on appetite suppression and weight loss, however, that have led its surge in popularity, with many hailing semaglutide as the new 'miracle drug for weight loss'. Despite its popularity, both the governmental and popular reception to the drug has largely been mixed. In this paper, we address a range of ethical concerns and argue that while many are legitimate, they do not provide conclusive reason not to prescribe semaglutide for weight loss.
open access ↗ · PMID 39848681 · DOI 10.1136/jme-2024-110374
Ischemic optic neuropathy with semaglutide: global observational analysis of sex- and formulation-specific risk — The British journal of ophthalmology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41807083 · DOI 10.1136/bjo-2025-328483
Ethical considerations for semaglutide use in children — Archives of disease in childhood 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41494820 · DOI 10.1136/archdischild-2025-329747
Semaglutide-induced transient intestinal ischemia: A case report — International journal of clinical pharmacology and therapeutics 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41467632 · DOI 10.5414/cp204861
The ethics of Wegovy: promoting autonomy in pediatric care — Medicine, health care, and philosophy 2026
Semaglutide, marketed as Wegovy, Ozempic, and Rybelsus, is a glucagon-like peptide-1 receptor agonist (GLP-1 RA) that has attracted significant global attention for its appetite-suppressing and weight-loss effects. Approved for pediatric use in children aged 12 and older, Wegovy has been described as a "miracle drug" and hailed as a potential solution to the so-called "obesity epidemic." However, prescribing medication to children raises complex ethical questions, including how best to respect young patients' autonomy and promote their well-being. This paper focuses on one such concern: the "argument from virtue." According to this view, Wegovy represents a morally problematic approach to weight loss because it circumvents the development of character traits-such as self-control and resilience-that are seen as integral to autonomy. We critically examine this argument, rejecting the claim…
open access ↗ · PMID 41065944 · DOI 10.1007/s11019-025-10300-8
Doctor who prescribed Ozempic and Wegovy to her partner has suspension extended — BMJ (Clinical research ed.) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42608058 · DOI 10.1136/bmj-2026-100590
Changes in Semaglutide Fills Following Expanded FDA and Medicare Policies — The American journal of managed care 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42640207 · DOI 10.37765/ajmc.2026.89983
Related
Tirzepatide
incretin · 8 citations
Retatrutide
incretin · 8 citations
Liraglutide
incretin · 8 citations
Exenatide
incretin · 8 citations
GLP-1 (7-37)
incretin · 8 citations
GIP
incretin · 8 citations