GLP-1 (7-37)

also known as glucagon-like peptide-1

research compound incretin metabolicendocrine no independent mass to check against

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

No independent molecular weight was available to check the sequence against.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	not characterised
molecular weight	3355.71 Da (computed from sequence)
computed backbone mass	3355.71 Da
length	31 residues
net charge (pH 7.4)	-1
mean hydropathy	-0.24
half-life	not characterised
delivery route	not characterised
PubChem CID	not characterised
PDB	not characterised
UniProt parent	P01275

Mechanism

Endogenous incretin; potentiates glucose-dependent insulin secretion.

Reported targets: GLP-1R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 98–128 of Pro-glucagon (180 aa)

…FVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFS…

Parent sequence from UniProt P01275. GLP-1 is a proglucagon cleavage product.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
insulin secretion	Drugs are not cutting it: Patient motivations for metabolic and bariatric su… Surgery 2026
gastric emptying delay	Glucagon-Like Peptide-1 Receptor Agonists for Obstructive Sleep Apnea With a… Otolaryngology--head and neck surgery : official journal of American Academy of Otolaryngology-Head and Neck Surgery 2026
satiety	Effects of Glucagon-Like Peptide-1 Receptor Agonists as Weight Loss Drugs on… Hormone and metabolic research = Hormon- und Stoffwechselforschung = Hormones et metabolisme 2026

Literature (8)

Drugs are not cutting it: Patient motivations for metabolic and bariatric surgery despite glucagon-like peptide-1 use — Surgery 2026