Exenatide

also known as Byetta, exendin-4

approved incretin metabolicendocrine modified — mass check n/a

295 heavy atoms · 585 bonds · drag to pan, scroll to zoom C184O60N50S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 45588096. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. C-terminal amide. Synthetic version of exendin-4, originally characterised from Heloderma suspectum venom.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C184H282N50O60S
molecular weight	4187 Da (PubChem)
computed backbone mass	4187.61 Da
length	39 residues
net charge (pH 7.4)	-3
mean hydropathy	-0.69
half-life	not characterised
delivery route	subcutaneous
PubChem CID	45588096
PDB	not characterised
UniProt parent	not characterised

Mechanism

GLP-1 receptor agonist resistant to DPP-4 cleavage.

Reported targets: GLP-1R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
glycaemic control	Exendin-4 improves neurodevelopmental outcome after neonatal germinal matrix… Cell death & disease 2026
weight loss	Exendin-4 as a multi-target therapy for Fetal Inflammatory Response Syndrome… Frontiers in neurology 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT01270191	The Effects of Short-Term Exenatide Therapy in Newly Diagnosed Type 2 Diabetic Patients	UNKNOWN	PHASE4
NCT06256419	Association of Gene Polymorphism With Susceptibility to T2DM and the Therapeutic Responses t	RECRUITING	NA
NCT02584075	Evaluate the Effect of Exenatide Treatment on Coronary Artery Endothelial Function	UNKNOWN	PHASE4
NCT00917267	A Study to Examine the Effects of Exenatide Once-Weekly Injection on Glucose Control and Saf	COMPLETED	PHASE3
NCT01855490	Study of the Acute Metabolic Effect of Exenatide in Type 1 Diabetes	COMPLETED	PHASE1

Literature (8)

Exendin-4 improves neurodevelopmental outcome after neonatal germinal matrix hemorrhage — Cell death & disease 2026