database / hormone
Neuropeptide Y
also known as NPY
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132350. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide; the amide is required for receptor binding.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C190H287N55O57 |
|---|---|
| molecular weight | 4254 Da (PubChem) |
| computed backbone mass | 4272.72 Da |
| length | 36 residues |
| net charge (pH 7.4) | 0 |
| mean hydropathy | -1.19 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 16132350 |
| PDB | not characterised |
| UniProt parent | P01303 |
Mechanism
Y1-Y5 receptor agonist; one of the most abundant neuropeptides in the brain.
Reported targets: Y1R Y2R Y5R
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Helical wheel
Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.
Position in the parent protein
…KRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPR…
Parent sequence from UniProt P01303. Cleaved from pro-NPY.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| appetite stimulation in models | Non-cell autonomous control of presynaptic remodeling by the hypothalamic au… Autophagy 2026 |
| anxiolytic-like activity in models | Neuropeptide Y promotes myocardial fibrosis post myocardial infarction reper… Clinical and experimental medicine 2026 |
Literature (8)
Non-cell autonomous control of presynaptic remodeling by the hypothalamic autophagy-NPY axis — Autophagy 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42609005 · DOI 10.1080/15548627.2026.2719429
Neuropeptide Y promotes myocardial fibrosis post myocardial infarction reperfusion through Neuropeptide Y receptor type 1 — Clinical and experimental medicine 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42472403 · DOI 10.1007/s10238-026-02253-w
Neuropeptide Y regulates myocardial fibrosis via NPY1R/JAK2/STAT3 signaling pathway — Biochemical pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42612877 · DOI 10.1016/j.bcp.2026.118372
Neuropeptide Y-Graphene Oxide Complexes Inhibit Amygdala NPY-Receptor Expressing Glutamatergic Pathways and Selectively Remove Aversive Memory In Vivo — Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42535973 · DOI 10.1002/advs.76608
Impact of serotonin transporter deficiency on parvalbumin- and neuropeptide Y-producing neurons of the lateral and basolateral amygdalar nuclei — Journal of neural transmission (Vienna, Austria : 1996) 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42616085 · DOI 10.1007/s00702-026-03224-x
Effects of photoperiod on gonadal development and neuropeptide Y and NPY1 receptor in Nile tilapia (Oreochromis niloticus) — Fish physiology and biochemistry 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42455188 · DOI 10.1007/s10695-026-01742-9
Neuropeptide Y in cancer metastasis and chemoresistance — Neuropeptides 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42314268 · DOI 10.1016/j.npep.2026.102638
Pro-neuropeptide Y as a circulating biomarker for poor prognosis in prostate cancer — Scientific reports 2026
Prostate cancer (PCa) is common world-wide. Current diagnostics based on testing for circulating levels of prostate specific antigen (PSA) is unspecific, and novel prognostic markers are needed for personalized therapeutic strategies. Pro-neuropeptide Y (pro-NPY) has been reported as a tissue marker for PCa related to poor prognosis. This study explored the prognostic value of circulating pro-NPY in PCa. Plasma samples were obtained from two patient cohorts: (1) men examined due to increased PSA levels in 2003-2011 (n = 796) and (2) patients treated for PCa in 2013-2016 (n = 92). Cohort 2 also provided plasma samples collected ~ 3 months after therapy. For plasma pro-NPY assessment, a sandwich immunoassay was developed. In cohort 1, 315 patients were diagnosed with PCa at the time for blood sampling, 137 were diagnosed during follow-up, and 344 remained disease-free. Plasma pro-NPY provi…
open access ↗ · PMID 42337319 · DOI 10.1038/s41598-026-58517-8
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations