biohacking$bioLLM CA: TBA

database / hormone

Neuropeptide Y

also known as NPY

research compound hormone nervousmetaboliccardiovascular modified — mass check n/a
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
302 heavy atoms · 598 bonds · drag to pan, scroll to zoom C190O57N55

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132350. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr

1. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y12. Pro — Proline · proline · hydropathy -1.6 · charge 0P3. Ser — Serine · polar · hydropathy -0.8 · charge 0S4. Lys — Lysine · positive · hydropathy -3.9 · charge +1K5. Pro — Proline · proline · hydropathy -1.6 · charge 0P6. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D67. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N8. Pro — Proline · proline · hydropathy -1.6 · charge 0P9. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D1112. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A13. Pro — Proline · proline · hydropathy -1.6 · charge 0P14. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A15. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E16. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D1617. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M18. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A19. Arg — Arginine · positive · hydropathy -4.5 · charge +1R20. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y21. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y2122. Ser — Serine · polar · hydropathy -0.8 · charge 0S23. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A24. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L25. Arg — Arginine · positive · hydropathy -4.5 · charge +1R26. His — Histidine · positive · hydropathy -3.2 · charge 0H2627. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y28. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I29. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N30. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L31. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I3132. Thr — Threonine · polar · hydropathy -0.7 · charge 0T33. Arg — Arginine · positive · hydropathy -4.5 · charge +1R34. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q35. Arg — Arginine · positive · hydropathy -4.5 · charge +1R36. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y36

Modified molecule. C-terminal amide; the amide is required for receptor binding.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC190H287N55O57
molecular weight4254 Da (PubChem)
computed backbone mass4272.72 Da
length36 residues
net charge (pH 7.4)0
mean hydropathy-1.19
half-lifenot characterised
delivery routenot characterised
PubChem CID16132350
PDBnot characterised
UniProt parentP01303

Mechanism

Y1-Y5 receptor agonist; one of the most abundant neuropeptides in the brain.

Reported targets: Y1R Y2R Y5R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

1. Tyr — Tyrosine · aromaticY2. Pro — Proline · prolineP3. Ser — Serine · polarS4. Lys — Lysine · positiveK5. Pro — Proline · prolineP6. Asp — Aspartic acid · negativeD7. Asn — Asparagine · polarN8. Pro — Proline · prolineP9. Gly — Glycine · glycineG10. Glu — Glutamic acid · negativeE11. Asp — Aspartic acid · negativeD12. Ala — Alanine · hydrophobicA13. Pro — Proline · prolineP14. Ala — Alanine · hydrophobicA15. Glu — Glutamic acid · negativeE16. Asp — Aspartic acid · negativeD17. Met — Methionine · hydrophobicM18. Ala — Alanine · hydrophobicA

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 29–64 of Pro-neuropeptide Y (97 aa)

…KRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPR…

Parent sequence from UniProt P01303. Cleaved from pro-NPY.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
appetite stimulation in modelsNon-cell autonomous control of presynaptic remodeling by the hypothalamic au… Autophagy 2026
anxiolytic-like activity in modelsNeuropeptide Y promotes myocardial fibrosis post myocardial infarction reper… Clinical and experimental medicine 2026

Literature (8)

Non-cell autonomous control of presynaptic remodeling by the hypothalamic autophagy-NPY axis — Autophagy 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42609005 · DOI 10.1080/15548627.2026.2719429

Neuropeptide Y promotes myocardial fibrosis post myocardial infarction reperfusion through Neuropeptide Y receptor type 1 — Clinical and experimental medicine 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42472403 · DOI 10.1007/s10238-026-02253-w

Neuropeptide Y regulates myocardial fibrosis via NPY1R/JAK2/STAT3 signaling pathway — Biochemical pharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42612877 · DOI 10.1016/j.bcp.2026.118372

Neuropeptide Y-Graphene Oxide Complexes Inhibit Amygdala NPY-Receptor Expressing Glutamatergic Pathways and Selectively Remove Aversive Memory In Vivo — Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42535973 · DOI 10.1002/advs.76608

Impact of serotonin transporter deficiency on parvalbumin- and neuropeptide Y-producing neurons of the lateral and basolateral amygdalar nuclei — Journal of neural transmission (Vienna, Austria : 1996) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42616085 · DOI 10.1007/s00702-026-03224-x

Effects of photoperiod on gonadal development and neuropeptide Y and NPY1 receptor in Nile tilapia (Oreochromis niloticus) — Fish physiology and biochemistry 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42455188 · DOI 10.1007/s10695-026-01742-9

Neuropeptide Y in cancer metastasis and chemoresistance — Neuropeptides 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42314268 · DOI 10.1016/j.npep.2026.102638

Pro-neuropeptide Y as a circulating biomarker for poor prognosis in prostate cancer — Scientific reports 2026

Prostate cancer (PCa) is common world-wide. Current diagnostics based on testing for circulating levels of prostate specific antigen (PSA) is unspecific, and novel prognostic markers are needed for personalized therapeutic strategies. Pro-neuropeptide Y (pro-NPY) has been reported as a tissue marker for PCa related to poor prognosis. This study explored the prognostic value of circulating pro-NPY in PCa. Plasma samples were obtained from two patient cohorts: (1) men examined due to increased PSA levels in 2003-2011 (n = 796) and (2) patients treated for PCa in 2013-2016 (n = 92). Cohort 2 also provided plasma samples collected ~ 3 months after therapy. For plasma pro-NPY assessment, a sandwich immunoassay was developed. In cohort 1, 315 patients were diagnosed with PCa at the time for blood sampling, 137 were diagnosed during follow-up, and 344 remained disease-free. Plasma pro-NPY provi…

open access ↗ · PMID 42337319 · DOI 10.1038/s41598-026-58517-8

Related

Glucagon

hormone · 8 citations

Ghrelin

hormone · 8 citations

Oxytocin

hormone · 8 citations

Vasopressin

hormone · 8 citations

Gonadorelin

hormone · 8 citations

Kisspeptin-10

hormone · 8 citations