Nesiritide

also known as BNP, B-type natriuretic peptide

approved hormone cardiovascularrenal modified — mass check n/a

239 heavy atoms · 486 bonds · drag to pan, scroll to zoom C143N50O42S4

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 71308561. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. Disulfide-bridged ring, as in the natriuretic peptide family.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C143H244N50O42S4
molecular weight	3464 Da (PubChem)
computed backbone mass	3466.08 Da
length	32 residues
net charge (pH 7.4)	+6
mean hydropathy	-0.51
half-life	not characterised
delivery route	intravenous
PubChem CID	71308561
PDB	not characterised
UniProt parent	P16860

Mechanism

NPR-A agonist; recombinant human B-type natriuretic peptide.

Reported targets: NPR-A

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 103–134 of Natriuretic peptides B (134 aa)

…SREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Parent sequence from UniProt P16860. Cleaved from the BNP precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
vasodilation	Rethinking B-type natriuretic peptide and N-terminal pro-B-type natriuretic … Research Square 2026
heart-failure outcomes in trials	Statistical approaches to make cardiac biomarkers compatible for efficient m… Journal of rural medicine : JRM 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT07532317	Comparison of Myval THV Series With Guideline-Directed Medical Therapy in Participants With	NOT_YET_RECRUITING	NA
NCT04304560	Value of SGLT2 Inhibitor (Dapagliflozin) as an Added Therapy in Diabetic Patients With Heart	UNKNOWN	PHASE2
NCT06009185	Safety and Efficacy of BIA 5-1058 in PAH	COMPLETED	PHASE2
NCT01822808	Bi Treatment With Hydralazine/Nitrates Versus Placebo in Africans Admitted With Acute Heart	UNKNOWN	PHASE3
NCT05636176	A Research Study to Look at How Ziltivekimab Works Compared to Placebo in People With Heart	ACTIVE_NOT_RECRUITING	PHASE3

Literature (8)

Rethinking B-type natriuretic peptide and N-terminal pro-B-type natriuretic peptide in hemodialysis patients — Research Square 2026