Leu-enkephalin

research compound hormone nervous mass-verified

40 heavy atoms · 78 bonds · drag to pan, scroll to zoom C28O7N5

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 461776. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

YGGFL

Tyr-Gly-Gly-Phe-Leu

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Computed backbone mass 555.63 Da agrees with PubChem's reported 555.6 Da (Δ 0.03 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C28H37N5O7
molecular weight	555.6 Da (PubChem)
computed backbone mass	555.63 Da
length	5 residues
net charge (pH 7.4)	0
mean hydropathy	0.9
half-life	not characterised
delivery route	not characterised
PubChem CID	461776
PDB	not characterised
UniProt parent	P01210

Mechanism

Endogenous opioid pentapeptide differing from Met-enkephalin at the C-terminal residue.

Reported targets: DOR

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 230–234 of Proenkephalin-A (267 aa)

…LQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEME…

Parent sequence from UniProt P01210. Released from proenkephalin.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
analgesic signalling	Heat and cold stresses exert disparate effects on expression of proenkephali… Poultry science 2026

Literature (7)

Heat and cold stresses exert disparate effects on expression of proenkephalin, and concentrations of Met-enkephalin in the hypothalamus, pituitary and adrenal glands, plasma concentrations Met-enkephalin, Leu-enkephalin, β-endorphin and corticosterone and opioid receptor binding in chickens — Poultry science 2026