database / hormone
Galanin
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16133823. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Computed backbone mass 3157.45 Da agrees with PubChem's reported 3157.4 Da (Δ 0.05 Da). Two independent sources agree on the primary structure.
Molecular data
| molecular formula | C139H210N42O43 |
|---|---|
| molecular weight | 3157.4 Da (PubChem) |
| computed backbone mass | 3157.45 Da |
| length | 30 residues |
| net charge (pH 7.4) | +1 |
| mean hydropathy | -0.45 |
| half-life | not characterised |
| delivery route | not characterised |
| PubChem CID | 16133823 |
| PDB | not characterised |
| UniProt parent | P22466 |
Mechanism
GAL1-3 receptor agonist; neuropeptide with roles in mood, feeding and nociception.
Reported targets: GALR1 GALR2 GALR3
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Position in the parent protein
…LASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNI…
Parent sequence from UniProt P22466. Cleaved from the galanin precursor.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| neuroprotection in models | Exploring the causal role and mechanism of galanin in glioblastoma: integrat… Frontiers in pharmacology 2026 |
| feeding behaviour in models | Neuropeptide Alterations in Type 2 Diabetes Mellitus: A Meta-Analysis of Cir… Endocrinology, diabetes & metabolism 2026 |
Literature (8)
Exploring the causal role and mechanism of galanin in glioblastoma: integration of mendelian randomization, network analysis, molecular docking and experimental validation — Frontiers in pharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42614515 · DOI 10.3389/fphar.2026.1916071
Neuropeptide Alterations in Type 2 Diabetes Mellitus: A Meta-Analysis of Circulating Spexin and Galanin Levels — Endocrinology, diabetes & metabolism 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42573161 · DOI 10.1002/edm2.70303
CSF galanin and noradrenaline downregulation by psilocybin therapy in major depressive disorder — Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42414566 · DOI 10.1038/s41386-026-02490-3
Galanin Inhibits Histaminergic Neurons via Galanin Receptor 1 — eNeuro 2026
Galanin-expressing neurons in the ventrolateral preoptic area (VLPOgalanin) are active during sleep and play an important role in regulating non-rapid eye movement (NREM) sleep. It is generally believed that VLPOgalanin neurons promote sleep via inhibitory actions in arousal-promoting regions of the brain. Histaminergic neurons are a population of wake-active neurons that receive strong projections from the sleep-active VLPOgalanin neurons. However, the ability of galanin to influence the activity of histaminergic neurons has received limited attention. Here, using whole-cell patch-clamp electrophysiological recordings from genetically identified histaminergic neurons in male mice, we explore the mechanisms by which galanin influences histaminergic neuron electrical excitability. Our results reveal that galanin is a powerful inhibitor of histaminergic neuron activity and demonstrate that…
open access ↗ · PMID 41651655 · DOI 10.1523/eneuro.0420-25.2026
Intravenous galanin (1-16) and a GalR1 agonist attenuate allodynia in rats with spared nerve injury — Pain reports 2026
IntroductionChronic pain is a major unmet medical need, with current treatments often providing limited relief. The neuropeptide galanin, acting through GalR1-3 receptors, has been implicated in pain modulation. Although galanin analogues are typically administered intrathecally, emerging evidence suggests that peptides can cross the blood-brain barrier. We hypothesized that systemic administration of the biologically active fragment galanin (1-16) could attenuate neuropathic pain.ObjectivesTo evaluate whether intravenous galanin (1-16) reduces pain-like behaviors in a rat model of neuropathic pain and to compare its effects when using a selective GalR1 agonist.MethodsMale Sprague-Dawley rats underwent spared nerve injury. Animals received intravenous galanin (1-16), M617 (selective GalR1), or vehicle. Mechanical and cold allodynia were assessed using von Frey filaments and acetone testi…
open access ↗ · PMID 41822106 · DOI 10.1097/pr9.0000000000001422
Galanin receptor 2: A multifunctional modulator in neurological diseases - Structure, mechanisms, and therapeutic prospects — Neuropeptides 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42269375 · DOI 10.1016/j.npep.2026.102634
Galanin Receptors: G Protein-Dependent Signaling and Beyond — Biomolecules 2026
The G protein-coupled galanin receptors include three different subtypes: galanin receptor 1, 2 and 3 (GalR1, GalR2, GalR3). The neuropeptide galanin is the principal natural agonist of the galanin receptors, the so-called galaninergic system. Galanin-like peptide and spexin have also been identified as natural ligands of the galanin receptors. Galanin receptors are widely expressed in the brain; however, they can be found in other tissues, such as the skeletal muscle, the heart, and the gastrointestinal tract. The galaninergic system regulates diverse biological processes, including feeding behavior, neuroprotection, learning, memory, cardiovascular and renal function, and nociception. Its dysregulation is associated with various diseases, such as Alzheimer's disease, diabetes mellitus, epilepsy, depression, and cancer. The stimulation of GalR1 and GalR3 leads to the Gαi/o-type G protei…
open access ↗ · PMID 41750307 · DOI 10.3390/biom16020236
Rotational TBI causes neuronal stress and changes in the monoamine and galanin systems — Experimental neurology 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41831549 · DOI 10.1016/j.expneurol.2026.115711
Related
Glucagon
hormone · 8 citations
Ghrelin
hormone · 8 citations
Oxytocin
hormone · 8 citations
Vasopressin
hormone · 8 citations
Gonadorelin
hormone · 8 citations
Kisspeptin-10
hormone · 8 citations