Bradykinin

research compound hormone cardiovascularnervousimmune mass-verified

76 heavy atoms · 153 bonds · drag to pan, scroll to zoom C50N15O11

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 439201. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

RPPGFSPFR

Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Computed backbone mass 1060.22 Da agrees with PubChem's reported 1060.2 Da (Δ 0.02 Da). Two independent sources agree on the primary structure.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C50H73N15O11
molecular weight	1060.2 Da (PubChem)
computed backbone mass	1060.22 Da
length	9 residues
net charge (pH 7.4)	+2
mean hydropathy	-1.04
half-life	not characterised
delivery route	not characterised
PubChem CID	439201
PDB	not characterised
UniProt parent	P01042

Mechanism

B2 receptor agonist; mediator of vasodilation and pain signalling.

Reported targets: BDKRB2

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 381–389 of Kininogen-1 (644 aa)

…VVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQ…

Parent sequence from UniProt P01042. Released from kininogen by kallikrein.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
vasodilation	Therapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vas… Clinical reviews in allergy & immunology 2026
pain signalling	G protein signaling capabilities at the bradykinin 2 receptor Naunyn-Schmiedeberg's archives of pharmacology 2026
vascular permeability	[Current and future therapies for bradykinin-mediated angioedema] Dermatologie (Heidelberg, Germany) 2026

Literature (8)

Therapeutic Targeting of the Bradykinin B2 Receptor in Immunological and Vascular Diseases: Insights from Kinin Biology to Clinical Outcomes — Clinical reviews in allergy & immunology 2026