Atrial natriuretic peptide

also known as ANP, atrial natriuretic factor

research compound hormone cardiovascularrenal modified — mass check n/a

214 heavy atoms · 420 bonds · drag to pan, scroll to zoom C127N45O39S3

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16129708. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

SLRRSSCFGGRMDRIGAQSGLGCNSFRY

Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. A Cys7–Cys23 disulfide forms the 17-residue ring required for activity.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C127H203N45O39S3
molecular weight	3080.5 Da (PubChem)
computed backbone mass	3082.48 Da
length	28 residues
net charge (pH 7.4)	+4
mean hydropathy	-0.5
half-life	not characterised
delivery route	not characterised
PubChem CID	16129708
PDB	not characterised
UniProt parent	P01160

Mechanism

NPR-A agonist; raises cGMP, promoting natriuresis and vasodilation.

Reported targets: NPR-A

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 124–151 of Natriuretic peptides A (151 aa)

…GPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

Parent sequence from UniProt P01160. Cleaved from the ANP precursor.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
natriuresis	Atrial Natriuretic Peptide Limits Oxidative Injury in Experimental Acute Pan… Research Square 2026
vasodilation	Reduced Left Atrial Reservoir Strain Is Associated with Histopathologically … Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography 2026
blood-pressure effects	Carperitide National Institute of Child Health and Human Development, Bethesda (MD) 2006

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT07532317	Comparison of Myval THV Series With Guideline-Directed Medical Therapy in Participants With	NOT_YET_RECRUITING	NA
NCT06009185	Safety and Efficacy of BIA 5-1058 in PAH	COMPLETED	PHASE2
NCT05636176	A Research Study to Look at How Ziltivekimab Works Compared to Placebo in People With Heart	ACTIVE_NOT_RECRUITING	PHASE3
NCT00213785	A Study of Plasmatic Concentrations of Endothelin-1 (ET1), Atrial Natriuretic Peptide (ANP)	COMPLETED	—
NCT06668389	Sodium-Glucose Cotransporter 2 Inhibitors for Repaired Tetralogy of Fallot Patients for Enha	RECRUITING	PHASE4

Literature (8)

Atrial Natriuretic Peptide Limits Oxidative Injury in Experimental Acute Pancreatitis Through Activation of Antioxidant Pathways — Research Square 2026