database / gh-secretagogue

Sermorelin

also known as GRF (1-29)

approved gh-secretagogue endocrine modified — mass check n/a

236 heavy atoms · 484 bonds · drag to pan, scroll to zoom C149N44O42S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16132413. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSR

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg

hydrophobic
positive
negative
polar
aromatic
glycine
proline
cysteine

Modified molecule. C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formula	C149H246N44O42S
molecular weight	3357.9 Da (PubChem)
computed backbone mass	3358.91 Da
length	29 residues
net charge (pH 7.4)	+3
mean hydropathy	-0.22
half-life	not characterised
delivery route	subcutaneous
PubChem CID	16132413
PDB	not characterised
UniProt parent	P01286

Mechanism

The N-terminal 29 residues of GHRH — the shortest fully active fragment.

Reported targets: GHRHR

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Position in the parent protein

exact match at residues 32–60 of Somatoliberin (108 aa)

…FVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWA…

Parent sequence from UniProt P01286. Residues 1-29 of GHRH.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcome	where it appears
GH release	Cationic exchange SPE combined with triple quadrupole UHPLC-MS/MS for detect… Analytical biochemistry 2023
IGF-1 elevation	Analysis of growth hormone releasing hormone and its analogs in urine using … Journal of pharmaceutical and biomedical analysis 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCT	title	status	phase
NCT01237041	Free Fatty Acids, Body Weight, and Growth Hormones Secretion in Children	TERMINATED	PHASE1, PHASE2
NCT01264497	Safety Study of TH9507 in Subjects With Stable, Type 2 Diabetes	COMPLETED	PHASE2
NCT03226821	Body Composition and Adipose Tissue in HIV	TERMINATED	PHASE4
NCT00507104	Pituitary Functions After Traumatic Brain Injury (TBI) and/or Subarachnoid Hemorrhage (SAH)	COMPLETED	—
NCT01632592	Abdominal Obesity, Cardiovascular Inflammation, and Effects of Growth Hormone Releasing Horm	WITHDRAWN	NA

Literature (8)

Cationic exchange SPE combined with triple quadrupole UHPLC-MS/MS for detection of GHRHs in urine samples — Analytical biochemistry 2023