biohacking$bioLLM CA: TBA

database / immune

Enfuvirtide

also known as T-20, Fuzeon

approved immune immune modified — mass check n/a
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
319 heavy atoms · 628 bonds · drag to pan, scroll to zoom C204O64N51

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16130199. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe

1. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y12. Thr — Threonine · polar · hydropathy -0.7 · charge 0T3. Ser — Serine · polar · hydropathy -0.8 · charge 0S4. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L5. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I6. His — Histidine · positive · hydropathy -3.2 · charge 0H67. Ser — Serine · polar · hydropathy -0.8 · charge 0S8. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L9. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E1112. Ser — Serine · polar · hydropathy -0.8 · charge 0S13. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q14. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N15. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q16. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q1617. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E18. Lys — Lysine · positive · hydropathy -3.9 · charge +1K19. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N20. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E21. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q2122. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E23. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L24. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L25. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E26. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L2627. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D28. Lys — Lysine · positive · hydropathy -3.9 · charge +1K29. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W30. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A31. Ser — Serine · polar · hydropathy -0.8 · charge 0S3132. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L33. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W34. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N35. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W36. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F36

Modified molecule. N-terminally acetylated with a C-terminal amide.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC204H301N51O64
molecular weight4492 Da (PubChem)
computed backbone mass4450.88 Da
length36 residues
net charge (pH 7.4)-5
mean hydropathy-0.87
half-lifenot characterised
delivery routesubcutaneous
PubChem CID16130199
PDBnot characterised
UniProt parentnot characterised

Mechanism

HIV-1 fusion inhibitor; binds gp41 and blocks the conformational change required for membrane fusion.

Reported targets: HIV-1 gp41

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Helical wheel

1. Tyr — Tyrosine · aromaticY2. Thr — Threonine · polarT3. Ser — Serine · polarS4. Leu — Leucine · hydrophobicL5. Ile — Isoleucine · hydrophobicI6. His — Histidine · positiveH7. Ser — Serine · polarS8. Leu — Leucine · hydrophobicL9. Ile — Isoleucine · hydrophobicI10. Glu — Glutamic acid · negativeE11. Glu — Glutamic acid · negativeE12. Ser — Serine · polarS13. Gln — Glutamine · polarQ14. Asn — Asparagine · polarN15. Gln — Glutamine · polarQ16. Gln — Glutamine · polarQ17. Glu — Glutamic acid · negativeE18. Lys — Lysine · positiveK

Residues projected at 100° per turn, the standard α-helix rotation. Shown because helicity in this peptide is described in the cited literature.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
viral load reduction in trialsCorrection to "Quality by Design-Guided Development of Hydrogel-Forming Micr… ACS applied materials & interfaces 2025

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT00008528T-20 With Anti-HIV Combination Therapy for Patients With Prior Anti-HIV Drug Treatment and/oCOMPLETEDPHASE3
NCT00461266ESP Study: A Study to Assess the Effect of Adding Fuzeon (Enfuvirtide) to an Antiretroviral WITHDRAWNPHASE4
NCT00460746Enfuvirtide/Current Protease Inhibitor Switch to PREZISTA (Darunavir)/Ritonavir + TMC125 in COMPLETEDPHASE3
NCT00657761Metabolic Effects of Enfuvirtide in Healthy VolunteersCOMPLETEDPHASE4
NCT00120367Early Intensification of Antiretroviral Therapy Including Enfuvirtide in HIV-1-Related ProgrCOMPLETEDPHASE2

Literature (7)

Correction to "Quality by Design-Guided Development of Hydrogel-Forming Microneedles for Transdermal Delivery of Enfuvirtide" — ACS applied materials & interfaces 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

open access ↗ · PMID 41115011 · DOI 10.1021/acsami.5c20308

Next-generation antiviral peptides: AI-driven design, translational delivery platforms, and future therapeutic directions — Virus research 2025

Antiviral peptides (AVPs) are emerging as next-generation therapeutics due to their broad-spectrum activity, low toxicity, and ability to overcome drug resistance. The objective of this review is to provide an integrated perspective on AVP research, with particular emphasis on artificial intelligence (AI)-driven discovery, novel delivery strategies, and translational applications. We first summarize the origins, mechanisms, and structural diversity of AVPs. We then highlight recent advances in computational pipelines, including machine learning, deep learning, generative adversarial networks (GANs), large language models (LLMs), and reinforcement learning frameworks for de novo peptide design. Translational aspects are addressed by discussing novel delivery systems such as nanoparticles, hydrogels, and intranasal/inhalable formulations, as well as clinical trial examples (like, enfuvirti…

open access ↗ · PMID 41106780 · DOI 10.1016/j.virusres.2025.199642

Transdermal delivery of enfuvirtide using dissolving microneedles integrated with novel insertion and removal indicator — Journal of controlled release : official journal of the Controlled Release Society 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 40532764 · DOI 10.1016/j.jconrel.2025.113954

Research strategies of the N-peptide fusion inhibitor: a promising direction for discovering novel antivirals — Journal of virology 2025

AIDS, caused by HIV-1, is a devastating condition that severely compromises the human immune system, often resulting in fatal consequences. The primary therapeutic approach for AIDS involves a combination of multiple agents, known as "cocktail therapy," aimed at maximizing and sustainably suppressing viral replication within patients. The ongoing discovery of novel compounds and the establishment of innovative research strategies have become the mandatory path to provide increasingly effective treatment options for AIDS. Peptide-based fusion inhibitors, exemplified as enfuvirtide, are able to target the six-helix bundle fusion core in HIV-1 envelope protein and function during the early stage of viral invasion. However, the prolonged and intensive use of enfuvirtide in clinical settings has posed significant challenges, including the emergence of drug resistance. N-peptide fusion inhibit…

open access ↗ · PMID 40207932 · DOI 10.1128/jvi.02289-24

Development of a HPLC fluorometric method for the quantification of enfuvirtide following in vitro releasing studies on thermosensitive in situ forming gel — Drug delivery and translational research 2023

Due to the presence of peptidase and protease in the gastrointestinal tract, peptides are subjected to digestion and inactivation when administrated orally. To avoid degradation and maintain the desired efficacy of peptide drugs, there is a demand to develop transdermal and intradermal delivery systems. This requires efficient and specific analytical methods to separate and quantify the peptide drugs from the formulation and the skin matrix in the early stages of pharmaceutical development. A high-performance liquid chromatography (HPLC) system equipped with a fluorometric detector was used to quantify enfuvirtide, which is the first fusion inhibitor for HIV treatment. The HPLC method was developed and validated according to the ICH Q2(R1) guidelines. The viability of the method was demonstrated during in vitro studies, where samples were analysed following intradermal administration of …

open access ↗ · PMID 37120679 · DOI 10.1007/s13346-023-01344-5

Quality by Design-Guided Development of Hydrogel-Forming Microneedles for Transdermal Delivery of Enfuvirtide — ACS applied materials & interfaces 2025

Enfuvirtide, the inaugural biomimetic fusion inhibitor of HIV-1, has exhibited remarkable antiviral efficacy when administered in conjunction with an optimized antiretroviral regimen. Nonetheless, the high incidence (98%) of injection site reactions associated with twice-daily subcutaneous administration severely compromises patient adherence and long-term therapeutic outcomes. This study proposes hydrogel-forming microneedles (MNs) as a minimally invasive and painless modality for the transdermal delivery of this therapeutic peptide. Leveraging a rigorous Quality by Design (QbD) framework, this investigation systematically delineated the critical material attributes (CMAs) and critical process parameters (CPPs) of the hydrogel formulation, mapping their influence on the critical quality attributes (CQAs) of MNs to achieve a meticulously defined quality-target product profile (QTPP). The…

open access ↗ · PMID 40063825 · DOI 10.1021/acsami.5c00499

Enfuvirtide — National Institute of Child Health and Human Development, Bethesda (MD) 2006

No published information is available on the use of enfuvirtide during breastfeeding. Enfuvirtide is not a recommended agent during breastfeeding.[1] Achieving and maintaining viral suppression with antiretroviral therapy decreases breastfeeding transmission risk to less than 1%, but not zero. Individuals with HIV who are on antiretroviral therapy with a sustained undetectable viral load and who choose to breastfeed should be supported in this decision. If a viral load is not suppressed, banked pasteurized donor milk or formula is recommended.[2,3]

open access ↗ · PMID 30000878

Related

KPV

immune · 8 citations

Tuftsin

immune · 8 citations

Thymosin α1

immune · 8 citations

LL-37

immune · 8 citations

Human β-defensin 2

immune · 8 citations

Thymulin

immune · 8 citations