database / metabolic
Pramlintide
also known as Symlin, amylin analogue
Skeletal structure drawn from the computed atomic coordinates in PubChem CID 70691388. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.
Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.
Sequence
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
- hydrophobic
- positive
- negative
- polar
- aromatic
- glycine
- proline
- cysteine
Modified molecule. C-terminal amide with a Cys2–Cys7 disulfide; proline substitutions at 25, 28 and 29 relative to human amylin prevent aggregation.
Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.
Molecular data
| molecular formula | C171H267N51O53S2 |
|---|---|
| molecular weight | 3949 Da (PubChem) |
| computed backbone mass | 3952.43 Da |
| length | 37 residues |
| net charge (pH 7.4) | +2 |
| mean hydropathy | -0.23 |
| half-life | not characterised |
| delivery route | subcutaneous |
| PubChem CID | 70691388 |
| PDB | not characterised |
| UniProt parent | not characterised |
Mechanism
Amylin analogue acting at amylin/calcitonin receptor complexes.
Reported targets: AMY receptors
Experimental structure
No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.
Reported effects
Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.
| reported outcome | where it appears |
|---|---|
| postprandial glucose control | Reversible peptide self-assembly enables sustained drug delivery with tuneab… bioRxiv 2026 |
| gastric emptying delay | The story of amylin: from physiology to therapy Nature metabolism 2026 |
| satiety | Amylin Analogs: The Next Major Class of Weight Loss Therapy: A Review of Exp… Diabetes, obesity & metabolism 2026 |
Registered trials
| NCT | title | status | phase |
|---|---|---|---|
| NCT00291772 | Continuous Subcutaneous Infusion of Pramlintide and Insulin | COMPLETED | PHASE4 |
| NCT00240253 | A Study Evaluating the Efficacy and Safety of Adding Symlin® to Lantus® (Insulin Glargine) i | COMPLETED | PHASE4 |
| NCT01235741 | A Study To Examine The Efficacy And Safety Of Pramlintide+Metreleptin In Obese Subjects | TERMINATED | PHASE2 |
| NCT00229658 | An Observational Study Evaluating SYMLIN® (Pramlintide Acetate) Injection Use in Insulin Usi | COMPLETED | — |
| NCT05199714 | A Fully-closed Loop, Pramlintide and Insulin, Artificial Pancreas Clinical Trial for Adults | COMPLETED | NA |
Literature (8)
Reversible peptide self-assembly enables sustained drug delivery with tuneable pharmacokinetics — bioRxiv 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.64898/2026.03.25.714189
The story of amylin: from physiology to therapy — Nature metabolism 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41708975 · DOI 10.1038/s42255-026-01465-4
Amylin Analogs: The Next Major Class of Weight Loss Therapy: A Review of Experimental Data and Early-Phase Clinical Trials — Diabetes, obesity & metabolism 2026
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 42452898 · DOI 10.1111/dom.71074
Pramlintide — National Institute of Child Health and Human Development, Bethesda (MD) 2006
Pramlintide has a high molecular weight, so it is unlikely to pass into breastmilk in clinically important amounts. It also has a short half-life, and it is a peptide that is likely digested in the infant's gastrointestinal tract, so it is unlikely to reach the clinically important levels in infant serum. However, because no information is available on the use of pramlintide during breastfeeding an alternate drug may be preferred, especially while nursing a newborn or preterm infant. Monitor breastfed infants for signs of hypoglycemia such as jitteriness, excessive sleepiness, poor feeding, seizures cyanosis, apnea, or hypothermia. If there is concern, monitoring of the breastfed infant's blood glucose is advisable during maternal therapy with pramlintide.[1]
open access ↗ · PMID 30000033
Combined amylin analogue and GLP1 receptor agonist therapies are highly promising for weight loss — Nature reviews. Endocrinology 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 40691511 · DOI 10.1038/s41574-025-01156-2
Oral delivery of the amylin receptor agonist pramlintide — bioRxiv 2023
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · DOI 10.1101/2023.11.09.566408
Central pramlintide administration potently suppresses operant responding for sucrose and locomotor activity in male rats — Physiology & behavior 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41022243 · DOI 10.1016/j.physbeh.2025.115114
A Pilot Outpatient Assessment of a Fully Closed-Loop Insulin and Pramlintide System — Journal of diabetes science and technology 2025
abstract not reproduced — this record is not open-access, so it is linked rather than copied.
publisher record ↗ · PMID 41174925 · DOI 10.1177/19322968251371046
Related
Teduglutide
metabolic · 8 citations
Leptin fragment (116-130)
metabolic · 6 citations
AOD-9604
metabolic · 8 citations
HGH Fragment 176-191
metabolic · 2 citations
Linaclotide
metabolic · 8 citations
Cagrilintide
metabolic · 8 citations