biohacking$bioLLM CA: TBA

database / melanocortin

α-MSH

also known as alpha-melanocyte stimulating hormone

research compound melanocortin integumentaryimmunenervous modified — mass check n/a
SOOOOOOOOOOOOOOOOOOONNNNNNNNNNNNNNNNNNNNNHHHHHHHHHHHHHHHHHHHHHHHHHH
118 heavy atoms · 232 bonds · drag to pan, scroll to zoom C77N21O19S1

Skeletal structure drawn from the computed atomic coordinates in PubChem CID 16133793. Carbons are implicit vertices; hydrogens on carbon are suppressed, as in any structural formula. Nothing here is estimated — every atom sits where PubChem placed it.

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

SYSMEHFRWGKPV

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val

1. Ser — Serine · polar · hydropathy -0.8 · charge 0S12. Tyr — Tyrosine · aromatic · hydropathy -1.3 · charge 0Y3. Ser — Serine · polar · hydropathy -0.8 · charge 0S4. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M5. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E6. His — Histidine · positive · hydropathy -3.2 · charge 0H67. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F8. Arg — Arginine · positive · hydropathy -4.5 · charge +1R9. Trp — Tryptophan · aromatic · hydropathy -0.9 · charge 0W10. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Pro — Proline · proline · hydropathy -1.6 · charge 0P13. Val — Valine · hydrophobic · hydropathy 4.2 · charge 0V13

Modified molecule. N-acetylated with a C-terminal amide in the endogenous form.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulaC77H109N21O19S
molecular weight1664.9 Da (PubChem)
computed backbone mass1623.85 Da
length13 residues
net charge (pH 7.4)+1
mean hydropathy-0.92
half-lifenot characterised
delivery routenot characterised
PubChem CID16133793
PDBnot characterised
UniProt parentP01189

Mechanism

Endogenous melanocortin agonist; the parent of the MT-I/MT-II analogue family.

Reported targets: MC1R MC3R MC4R MC5R

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 138–150 of Pro-opiomelanocortin (267 aa)

…GPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPL…

Parent sequence from UniProt P01189. α-MSH is the ACTH(1-13) cleavage product of POMC.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
melanogenesisAlpha-melanocyte-stimulating hormone promotes functional recovery in periphe… Neuropharmacology 2026
anti-inflammatory activityCorrigendum to "Desacetyl-alpha-melanocyte stimulating hormone and alpha-mel… Molecular metabolism 2026

Literature (8)

Alpha-melanocyte-stimulating hormone promotes functional recovery in peripheral olfactory dysfunction by modulating bulbar neuroinflammation and enhancing neuronal maturation — Neuropharmacology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42492629 · DOI 10.1016/j.neuropharm.2026.111115

Corrigendum to "Desacetyl-alpha-melanocyte stimulating hormone and alpha-melanocyte stimulating hormone are required to regulate energy balance" [Mol Metab 9 (2018) 207-216/29226825] — Molecular metabolism 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42097551 · DOI 10.1016/j.molmet.2026.102380

Treatment of nitrogen mustard-induced corneal injury with alpha-melanocyte stimulating hormone — Experimental eye research 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 40639768 · DOI 10.1016/j.exer.2025.110515

Dissecting the Impact of α-MSH-MC1R-cAMP Signaling on UVA-Induced Stress in Fibroblasts - Implications for Regulation of Cutaneous Photoaging — Aging and disease 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41747169 · DOI 10.14336/ad.2025.1518

Ethanolic Extract of <i>Padina arborescens</i> Suppresses Melanogenesis and Attenuates UVB-Induced Photodamage in Cellular and Zebrafish Models — International journal of molecular sciences 2026

Ultraviolet (UV) irradiation induces complex skin damage, including hyperpigmentation, oxidative stress, and alterations in proteins related to keratinocyte differentiation and epidermal barrier-associated status. This study investigated the multifunctional protective effects of Padina arborescens ethanolic extract (PAEE) against skin damage in melanocytes, keratinocytes, and zebrafish. In alpha-melanocyte-stimulating hormone (α-MSH)-stimulated B16F10 cells, PAEE effectively suppressed the protein kinase A (PKA)/cyclic adenosine monophosphate (cAMP) response element-binding protein (CREB) signaling pathway, which was associated with reduced expression of microphthalmia-associated transcription factor (MITF) and tyrosinase, leading to decreased melanin synthesis. PAEE also exhibited photoprotective properties by reducing reactive oxygen species (ROS), inhibiting interleukin-1 beta (IL-1β)…

open access ↗ · PMID 42074027 · DOI 10.3390/ijms27083382

Anti-inflammatory treatment using alpha melanocyte stimulating hormone (α-MSH) does not alter osteoblasts differentiation and fracture healing — BMC musculoskeletal disorders 2025

BackgroundAlpha-melanocyte-stimulating-hormone (α-MSH) has been identified as a new anti-inflammatory treatment compound in rheumatoid arthritis (RA) and other inflammatory diseases. However, its direct effect on bone cell differentiation or on bone regeneration, which is an inflammatory process, too, has not been investigated, yet. Bone tissue is significantly affected in inflammatory joint diseases. Additionally, inflammatory signaling is essential -in bone regeneration during fracture healing. Therefore, we evaluated the impact of α-MSH-treatment on bone forming cells in an inflammatory setting in vitro and as a treatment approach in a murine fracture healing model in vivo.MethodsThe influence of α-MSH treatment and melanocortin-receptor expression patterns was investigated in vitro in the presence of either IL-1β or/and TNF-α as an inflammatory stimulus. Osteoblast cell function was …

open access ↗ · PMID 39915758 · DOI 10.1186/s12891-025-08374-9

Effects of melanocortin receptor agonists and antagonists on exploratory activity: a review — General and comparative endocrinology 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41558543 · DOI 10.1016/j.ygcen.2026.114885

Comparative Efficacy of Skin-Lightening Formulations in Suppressing Ultraviolet B (UVB)-Induced Arachidonic Acid, Alpha-Melanocyte-Stimulating Hormone (α-MSH), and Melanin Expression: An In Vitro Keratinocyte-Melanocyte Co-culture Study — Cureus 2025

BackgroundMelasma is a chronic hyperpigmentary disorder exacerbated by sun exposure, characterized by asymptomatic hyperpigmented macules and patches. Its pathogenesis involves ultraviolet B (UVB)-induced activation of melanogenesis pathways, including arachidonic acid (AA) metabolism, alpha-melanocyte-stimulating hormone (α-MSH) secretion, and melanin synthesis. This study aimed to evaluate the efficacy of a multi-ingredient skin-lightening formulation (3% tranexamic acid, 2% ascorbyl glucoside, 2.5% arbutin, and 5% niacinamide) compared to a 10% vitamin C preparation and 4% hydroquinone (HQ) in suppressing UVB-induced AA, α-MSH, and melanin production in a keratinocyte-melanocyte co-culture model.MethodsKeratinocyte-melanocyte co-cultures were pretreated with the multi-ingredient formulation, 10% vitamin C, or 4% HQ before UVB irradiation (150 mJ/cm2). Distilled water served as the neg…

open access ↗ · PMID 40091954 · DOI 10.7759/cureus.78908

Related

Melanotan II

melanocortin · 8 citations

Afamelanotide

melanocortin · 8 citations

Bremelanotide

melanocortin · 8 citations

Setmelanotide

melanocortin · 8 citations