biohacking$bioLLM CA: TBA

database / healing

Thymosin β4

also known as Tβ4, TMSB4X

in clinical study healing musculoskeletalcardiovascularintegumentaryocular modified — mass check n/a

Research reference only. The observations below are recorded in the cited literature. Nothing here is advice or a recommendation, and no dosing information is published on this site.

Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser

1. Ser — Serine · polar · hydropathy -0.8 · charge 0S12. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D3. Lys — Lysine · positive · hydropathy -3.9 · charge +1K4. Pro — Proline · proline · hydropathy -1.6 · charge 0P5. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D6. Met — Methionine · hydrophobic · hydropathy 1.9 · charge 0M67. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A8. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E9. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I10. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E11. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1112. Phe — Phenylalanine · aromatic · hydropathy 2.8 · charge 0F13. Asp — Aspartic acid · negative · hydropathy -3.5 · charge −1D14. Lys — Lysine · positive · hydropathy -3.9 · charge +1K15. Ser — Serine · polar · hydropathy -0.8 · charge 0S16. Lys — Lysine · positive · hydropathy -3.9 · charge +1K1617. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L18. Lys — Lysine · positive · hydropathy -3.9 · charge +1K19. Lys — Lysine · positive · hydropathy -3.9 · charge +1K20. Thr — Threonine · polar · hydropathy -0.7 · charge 0T21. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E2122. Thr — Threonine · polar · hydropathy -0.7 · charge 0T23. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q24. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E25. Lys — Lysine · positive · hydropathy -3.9 · charge +1K26. Asn — Asparagine · polar · hydropathy -3.5 · charge 0N2627. Pro — Proline · proline · hydropathy -1.6 · charge 0P28. Leu — Leucine · hydrophobic · hydropathy 3.8 · charge 0L29. Pro — Proline · proline · hydropathy -1.6 · charge 0P30. Ser — Serine · polar · hydropathy -0.8 · charge 0S31. Lys — Lysine · positive · hydropathy -3.9 · charge +1K3132. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E33. Thr — Threonine · polar · hydropathy -0.7 · charge 0T34. Ile — Isoleucine · hydrophobic · hydropathy 4.5 · charge 0I35. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E36. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q3637. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E38. Lys — Lysine · positive · hydropathy -3.9 · charge +1K39. Gln — Glutamine · polar · hydropathy -3.5 · charge 0Q40. Ala — Alanine · hydrophobic · hydropathy 1.8 · charge 0A41. Gly — Glycine · glycine · hydropathy -0.4 · charge 0G4142. Glu — Glutamic acid · negative · hydropathy -3.5 · charge −1E43. Ser — Serine · polar · hydropathy -0.8 · charge 0S43

Modified molecule. N-terminally acetylated in vivo.

Backbone carries modifications, so computed backbone mass is not comparable to the reported mass of the complete molecule.

Molecular data

Chemical fields come from the PubChem compound record; computed values are derived from the sequence shown above.
molecular formulanot characterised
molecular weight4921.46 Da (computed from sequence)
computed backbone mass4921.46 Da
length43 residues
net charge (pH 7.4)-2
mean hydropathy-1.7
half-lifenot characterised
delivery routenot characterised
PubChem CIDnot characterised
PDBnot characterised
UniProt parentP62328

Mechanism

G-actin sequestering protein; studied in wound repair, corneal healing and cardiac injury models.

Reported targets: G-actin

Experimental structure

No experimental structure of this peptide is deposited in the PDB. Nothing is rendered here — a predicted fold would not be a structure, and this site does not draw one.

Position in the parent protein

exact match at residues 2–44 of Thymosin beta-4 (44 aa)

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Parent sequence from UniProt P62328. The full endogenous protein.

Reported effects

Each row is an outcome described in the literature indexed for this peptide. Reported in the cited work — not a claim, not a recommendation.

Reported observations and the corpus they are drawn from.
reported outcomewhere it appears
wound healingEffects of Supplementation in Masters Athletes and Older Adults: A Narrative… Current sports medicine reports 2026
corneal repairThymosin Beta-4 and TB-500 in Tissue Healing, Regeneration, and Musculoskele… Preprints.org 2026
anti-inflammatory activitySafety and Efficacy of Approved and Unapproved Peptide Therapies for Musculo… Sports medicine (Auckland, N.Z.) 2026

Registered trials

Records from ClinicalTrials.gov. Listed for reference — this project sponsors no trial and is not involved in any of them.
NCTtitlestatusphase
NCT00382174Study of Thymosin Beta 4 in Patients With Pressure UlcersCOMPLETEDPHASE2
NCT00598871A Phase 2 Study of the Safety and Efficacy of Thymosin Beta 4 for Treating Corneal WoundsTERMINATEDPHASE2
NCT03937882Assessment of the Safety and Efficacy of RGN-259 Ophthalmic Solutions for Dry Eye Syndrome: COMPLETEDPHASE3
NCT00311766A Phase 2 Study on Effect of Thymosin Beta 4 on Wound Healing in Patients With EpidermolysisTERMINATEDPHASE2
NCT00743769A Phase 1 Safety Study of the Intravenous Administration of Thymosin Beta in Healthy VolunteWITHDRAWNPHASE1

Literature (8)

Effects of Supplementation in Masters Athletes and Older Adults: A Narrative Review — Current sports medicine reports 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42385164 · DOI 10.1249/jsr.0000000000001353

Thymosin Beta-4 and TB-500 in Tissue Healing, Regeneration, and Musculoskeletal Repair: A Scoping Review — Preprints.org 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.20944/preprints202605.1124.v1

Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance — Sports medicine (Auckland, N.Z.) 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41966639 · DOI 10.1007/s40279-026-02437-0

Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance — Preprints.org 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · DOI 10.20944/preprints202512.1011.v3

Retraction: The role of thymosin beta 4 on odontogenic differentiation in human dental pulp cells — PloS one 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

open access ↗ · PMID 40029897 · DOI 10.1371/journal.pone.0320021

Thymosin beta 4 as an Alzheimer disease intervention target identified using human brain organoids — Stem cell reports 2025

The developmental origin of Alzheimer disease (AD) has been proposed but is arguably debated. Here, we developed cerebral organoids from induced pluripotent stem cells (iPSCs) with mutations in amyloid precursor protein (APP) associated with familial AD (fAD) and analyzed the dynamic changes of cellular states. We found that mature neurons induced in fAD organoids markedly decreased compared to that of health control, accompanied with increased cell senescence and β-amyloid (Aβ) production. Interestingly, the expression level of the gene TMSB4X that encodes thymosin beta 4 (Tβ4) significantly decreased both in fAD organoids' neurons and AD patients' excitatory neurons. Remarkably, the neurodevelopmental deficits and Aβ formation in fAD organoids were rescued by treatment with Tβ4. The beneficial effects of Tβ4 were also revealed in 5xfAD model mice. Thus, this study has identified Tβ4 as…

open access ↗ · PMID 40816274 · DOI 10.1016/j.stemcr.2025.102601

Recombinant human thymosin beta 4 improves ischemic cardiac dysfunction in mice and patients with acute ST-segment elevation myocardial infarction after reperfusion — Cardiovascular research 2025

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 41229390 · DOI 10.1093/cvr/cvaf223

Understanding the effects of ciprofloxacin on corneal epithelial cells: a study using electric cell-substrate impedance sensing (ECIS) technology — Experimental eye research 2026

abstract not reproduced — this record is not open-access, so it is linked rather than copied.

publisher record ↗ · PMID 42431294 · DOI 10.1016/j.exer.2026.111162

Related

BPC-157

healing · 8 citations

TB-500

healing · 8 citations

GHK

healing · 8 citations

Larazotide

healing · 3 citations